Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO16514	CP2	3.7e-39	5.5e-35	2	+ View
HMM length of domain: 229 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 120.7 0.2 9.8e-39 5.5e-35 23 161 239 369 2 19.9 2.0 6.2e-08 0.00035 204 227 367 390 Alignments for each domain: == domain 1 score: 120.7 bits; conditional E-value: 9.8e-39 CP2 23 esavssstekfrfevtLeaptamakkvneepltYLNkGQaYsislkdlgaaklselkgkklksvirvvFeeekqrkkeaklwklWkegrgseavrv 118 + + ss ++++rf+++L+a+t++a+k+nee+ltYLN+GQ+Y+i+lk+lg +ls++kgk lksvi++ F+e++++++e++++++W+++r+ e r+ KWMTBOMO16514 239 QRSDSSFKDDTRFQYVLAAATSIATKQNEETLTYLNQGQSYEIKLKKLG--DLSHYKGKLLKSVIKICFHERRLQYMEREQIAQWHAERPGE--RI 330 4555667899*************************************..*************************************..55 PP CP2 119 vdi..pls.ggveeqkntqvelesssfdaveftWngeeeakifvrv 161 v++ pls g+++ ++ ++++a+++ W+ +++++++++v KWMTBOMO16514 331 VEVdvPLSyGIIKVEQS-------TALNALHVYWDATKDVGVYIKV 369 55555999988876.......89***************97 PP == domain 2 score: 19.9 bits; conditional E-value: 6.2e-08 CP2 204 vKlFrdkGAeRKlkndvakvkkki 227 +K+F+ kGA+RK+k+d++kv +++ KWMTBOMO16514 367 IKVFKLKGADRKHKQDREKVLRRP 390 9*****************9875 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO16514

CP2

3.7e-39

5.5e-35

+ View

						  HMM length of domain: 229 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	120.7	0.2	9.8e-39	5.5e-35	23	161	239	369
2	19.9	2.0	6.2e-08	0.00035	204	227	367	390

  Alignments for each domain:
  == domain 1  score: 120.7 bits;  conditional E-value: 9.8e-39
            CP2  23 esavssstekfrfevtLeaptamakkvneepltYLNkGQaYsislkdlgaaklselkgkklksvirvvFeeekqrkkeaklwklWkegrgseavrv 118
                    + + ss ++++rf+++L+a+t++a+k+nee+ltYLN+GQ+Y+i+lk+lg  +ls++kgk lksvi++ F+e++++++e++++++W+++r+ e  r+
  KWMTBOMO16514 239 QRSDSSFKDDTRFQYVLAAATSIATKQNEETLTYLNQGQSYEIKLKKLG--DLSHYKGKLLKSVIKICFHERRLQYMEREQIAQWHAERPGE--RI 330
                    4555667899***************************************..*****************************************..55 PP

            CP2 119 vdi..pls.ggveeqkntqvelesssfdaveftWngeeeakifvrv 161
                    v++  pls g+++ ++        ++++a+++ W+ +++++++++v
  KWMTBOMO16514 331 VEVdvPLSyGIIKVEQS-------TALNALHVYWDATKDVGVYIKV 369
                    55555***999988876.......89******************97 PP

  == domain 2  score: 19.9 bits;  conditional E-value: 6.2e-08
            CP2 204 vKlFrdkGAeRKlkndvakvkkki 227
                    +K+F+ kGA+RK+k+d++kv +++
  KWMTBOMO16514 367 IKVFKLKGADRKHKQDREKVLRRP 390
                    9*******************9875 PP