| Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
|---|---|---|---|---|---|
| KWMTBOMO16519 | PLU-1 | 0.00086 | 0.0015 | 2 | + View |
HMM length of domain: 334 aa
c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified.
Domain annotation for each sequence:
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to
-- ----- ---- -------- -------- ------- ------ ------- ------
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 17.7 2.2 2.6e-07 0.0015 21 106 35 118
2 1.4 0.0 0.025 1.4e+02 195 227 137 166
Alignments for each domain:
== domain 1 score: 17.7 bits; conditional E-value: 2.6e-07
PLU-1 21 lrsllneaekikfplkelleeLksfvkeaekwvekaqqllskkqrtRrkneaeeeeeekeklsleelekLleeldslpFdlpeieq 106
l +l++ ++ +++ l++eL ++ ++a ++++ + + k++ Rrk + + + e+++ le++++Ll+++++ +F+ + ++
KWMTBOMO16519 35 LVKLVTAERHLHGDSTRLSRELATIENDARAALQLGNRIA-AKNHLRRKHK-VQRKLEQCTKALENVQNLLQQMRDVHFNASIVDT 118
5567777777788889999999999999998888777777.6778888888.8999***********************9987665 PP
== domain 2 score: 1.4 bits; conditional E-value: 0.025
PLU-1 195 laispekeellaklqelleaaekweekakelLe 227
+ + ++ ++ l+e ++ ++e + + ++
KWMTBOMO16519 137 VDT---VHDTMDDLKEVMDSYSEMERALGTTID 166
332...255666666666555555555444443 PP
|
|||||

渝公网安备 50010602502065号