Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
---|---|---|---|---|---|
KWMTBOMO15965 | MYB | 1.6e-05 | 0.0031 | 7 | + View |
HMM length of domain: 47 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 3.1 0.1 0.1 1e+02 3 14 76 87 2 -3.2 0.0 9.3 9.2e+03 22 40 335 351 3 0.5 0.0 0.65 6.5e+02 25 46 436 456 4 10.8 0.1 0.00041 0.41 17 47 562 591 5 17.6 0.0 3.1e-06 0.0031 2 46 640 692 6 -2.8 0.1 7.2 7.1e+03 22 45 903 932 7 -0.9 0.6 1.8 1.8e+03 3 17 1066 1080 Alignments for each domain: == domain 1 score: 3.1 bits; conditional E-value: 0.1 SS-HHHHHHHHH CS MYB 3 kWteeEdelLle 14 +Wt eE ++Ll KWMTBOMO15965 76 NWTDEEIQRLLV 87 7********985 PP == domain 2 score: -3.2 bits; conditional E-value: 9.3 TTHHHHHHHHSSS-HHHHH CS MYB 22 gnWkkIakelggRtakqcr 40 W++I+++l + a c+ KWMTBOMO15965 335 L-WNEISRLLD-KPADLCK 351 4.****99984.4544444 PP == domain 3 score: 0.5 bits; conditional E-value: 0.65 HHHHHHHSSS-HHHHHHHHHHH CS MYB 25 kkIakelggRtakqcrsrwqny 46 Iak l R +++ +wq + KWMTBOMO15965 436 GVIAKNLK-RKVGSVKRKWQEL 456 57999995.7778******976 PP == domain 4 score: 10.8 bits; conditional E-value: 0.00041 HHHTTTTHHHHHHHHSSS-HHHHHHHHHHHT CS MYB 17 eklGngnWkkIakelggRtakqcrsrwqnyl 47 +k+ n+ W+ a +lg ta qc +r++n++ KWMTBOMO15965 562 NKNKNTLWNVLAPRLG-ITATQCAHRFRNLK 591 5677889********6.89999*******86 PP == domain 5 score: 17.6 bits; conditional E-value: 3.1e-06 SSS-HHHHHHHHHHHHHHTTT.........THHHHHHHHSSS-HHHHHHHHHHH CS MYB 2 gkWteeEdelLleaveklGng.........nWkkIakelggRtakqcrsrwqny 46 W++ E + L++ + k+ + W+ Ia+e+ +t ++c+++++ + KWMTBOMO15965 640 EDWSPKEIKSLINFFSKNFHDitnniddasHWRPIAAEI-DKTTNSCKDKFLEL 692 57****************999******************.69*********976 PP == domain 6 score: -2.8 bits; conditional E-value: 7.2 TTHHHHHHHHS......SS-HHHHHHHHHH CS MYB 22 gnWkkIakelg......gRtakqcrsrwqn 45 + W+ I k+l +++ ++r+++ KWMTBOMO15965 903 DMWRDIGKKLDrrpiicKKMLAKLKNRYLK 932 568888888886666666666666777766 PP == domain 7 score: -0.9 bits; conditional E-value: 1.8 SS-HHHHHHHHHHHH CS MYB 3 kWteeEdelLleave 17 +W+e + e+Lle KWMTBOMO15965 1066 PWSETDVEQLLEWYL 1080 688888777777544 PP |
渝公网安备 50010602502065号