Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
---|---|---|---|---|---|
KWMTBOMO15655 | MYB | 8.6e-35 | 2.4e-07 | 6 | + View |
HMM length of domain: 47 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 -2.9 0.0 7.7 7.6e+03 23 34 222 233 2 29.0 0.1 8.5e-10 8.5e-07 1 45 253 298 3 23.4 0.1 4.8e-08 4.8e-05 3 45 308 353 4 30.7 0.0 2.4e-10 2.4e-07 1 45 359 402 5 29.0 0.0 8.2e-10 8.2e-07 3 47 411 456 6 -2.2 0.0 4.6 4.6e+03 29 41 492 504 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 7.7 THHHHHHHHSSS CS MYB 23 nWkkIakelggR 34 +W+ a++l++R KWMTBOMO15655 222 DWDVLANKLNRR 233 5*******9966 PP == domain 2 score: 29.0 bits; conditional E-value: 8.5e-10 CSSS-HHHHHHHHHHHHHHTTTTHHHHHHHHS.SS-HHHHHHHHHH CS MYB 1 rgkWteeEdelLleaveklGngnWkkIakelg.gRtakqcrsrwqn 45 +++Wt+ E++ L + +W++Iakel+ gRt+ qc ++++ KWMTBOMO15655 253 KKTWTKAEHLSLQSISSAHKFQDWDTIAKELNtGRTGYQCFVYFRT 298 689*************************************999987 PP == domain 3 score: 23.4 bits; conditional E-value: 4.8e-08 SS-HHHHHHHHHHHHHHTTT...THHHHHHHHSSS-HHHHHHHHHH CS MYB 3 kWteeEdelLleaveklGng...nWkkIakelggRtakqcrsrwqn 45 kWteeE+e L++++ + + W ++a+ + +Rt+ q+ +++ KWMTBOMO15655 308 KWTEEEEEYLRRLIDYYREDtyiPWGRVAAAMENRTKIQIYNKYTR 353 8******************************************976 PP == domain 4 score: 30.7 bits; conditional E-value: 2.4e-10 CSSS-HHHHHHHHHHHHHHTTTTHHHHHHHHSSS-HHHHHHHHHH CS MYB 1 rgkWteeEdelLleaveklGngnWkkIakelggRtakqcrsrwqn 45 +g++ +eEd +l++ +k+G++ ++k + +l+gR+ q+r+r++ KWMTBOMO15655 359 KGRFLPEEDAVILNYANKFGTN-FRKMLTYLPGRSMVQIRNRYRV 402 7999****************98.********************96 PP == domain 5 score: 29.0 bits; conditional E-value: 8.2e-10 SS-HHHHHHHHHHHHHHTTT.THHHHHHHHSSS-HHHHHHHHHHHT CS MYB 3 kWteeEdelLleaveklGng.nWkkIakelggRtakqcrsrwqnyl 47 WteeEd+ L+++ + ++ n+++++ +++g+ +++ rsr+ ++l KWMTBOMO15655 411 VWTEEEDKMLIQLMANQDGNvNFSSVSTHFPGKDRENLRSRYITLL 456 6***************99889*********************9876 PP == domain 6 score: -2.2 bits; conditional E-value: 4.6 HHHSSS-HHHHHH CS MYB 29 kelggRtakqcrs 41 + l +R++++++ KWMTBOMO15655 492 EDLKNRMENEVKT 504 567899***9986 PP |
渝公网安备 50010602502065号