Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
---|---|---|---|---|---|
KWMTBOMO12738 | NCU-G1 | 2.5e-105 | 2.9e-105 | 1 | + View |
HMM length of domain: 361 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 352.1 0.2 1.7e-109 2.9e-105 1 360 38 378 Alignments for each domain: == domain 1 score: 352.1 bits; conditional E-value: 1.7e-109 NCU-G1 1 tlvhiraegsndtlHflwsss.gaptillahtssssseLnvnWtkllssnvsgsitlepenvqysyavvlsklleynDvndtadlsetnkqstfip 95 tlv+i+a++s+d++H lw+++ g pt+++a t+ +s+ ++v+W++ + + + l++++ +y++a+ ++kl+eynDv+d++++s++ +q+ KWMTBOMO12738 38 TLVYIKADSSKDSIHQLWDFTgGIPTVVFALTELNST-MQVKWDRQV----PVKFLLSETP-KYCFAIAIDKLYEYNDVEDKGHISPQCEQR---- 123 69*******************888*************.******995....678*******.************************955555.... PP NCU-G1 96 lydlknfaWtrtsstlndssvsaelegatysesetslsrngsiavklsafeskgrsaelPhllhtpnstqvdlvldgltpr..fnnSRfaLelllv 189 +++lk ++Wt+++s l+d++v+ +++g + +++ r g ++vkl++ +++aelP+l+ht+nst vd+ l ++t+ +n+SRfaL++llv KWMTBOMO12738 124 PMSLKYMSWTLVDSVLSDKEVMVRVHG-----QYKHSWRAGVVDVKLDLIPFYDYAAELPRLIHTANSTLVDVGLVNITTSkdYNSSRFALHMLLV 214 6**************************.....77889*****************************************76668************* PP NCU-G1 190 sedeeesefklesersiDDEytPgvFelselltekansasstggflqwkpvaYtskdravenstevqqsklkstsvsstkslpnstllsafygdal 285 s+d +++++++++s+DDE+tPgvFe++e++t+++ ++ gg++q++pv Yt+++r+v++st+v+ s+lk+ + +p++++l+ f+ d KWMTBOMO12738 215 STDGWGETMHYTMRKSLDDEHTPGVFEIIEIKTPESYVKD-DGGYIQFRPVGYTEPKREVSSSTSVRVSPLKK------SAVPERSTLERFFRDFE 303 ****99*****************************99955.7******************************9......469************** PP NCU-G1 286 sksllvrelnvsfGskgdgfykatnylsWtallGlGePpedkfSllviliiavglgvpllllilggiyvvvkrrr 360 ++sllv++++vs+G +gd+fy+++n++sW++++G+G+Pp ++fSl+vi+ii++glgvplll + g +yvv+ r r KWMTBOMO12738 304 TESLLVQDVFVSIGLTGDQFYRQHNFTSWSFTMGYGSPPLETFSLFVIMIISIGLGVPLLLALSGVVYVVISRIR 378 ************************************************************************987 PP |
渝公网安备 50010602502065号