Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO11408	RXR-like	4.9e-61	6.6e-61	1	+ View
HMM length of domain: 202 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 205.6 0.0 6.6e-64 6.6e-61 1 198 202 396 Alignments for each domain: == domain 1 score: 205.6 bits; conditional E-value: 6.6e-64 RXR-like 1 icetaarlLfllVewaksipafseLpledqviLLrasWaelliLalaqtsiplsdaqlllasglsvarnsaek..evekildle....evrvLqel 90 +c++ +++L+ lVewak+ipaf+eL l+dqv+LLra++ e+l+L+ a++s++l+d lll++++ +++++ ++ + ++ +rv++e+ KWMTBOMO11408 202 VCDSIKQQLLILVEWAKYIPAFTELHLDDQVALLRAHAGEHLLLGCARRSLHLKDI-LLLGNNCIITKHNIDGrmD------IDismiGMRVMDEI 290 8****************************************************9.9999999999987777442......22224588** PP RXR-like 91 vtklrdlqldatEyacLkaIvlfnpdtdaagleerskieslrekvqasleeyiqdqypeqpgrFgklLlrLpalrsissktieelffskliGdtpi 186 v++lr++++d+tE+acLkaIv+f+p +a+gl++++ki++lr + q +le+yi+d++++ +grFg+lLl Lp l+si++++ie+++f+kl+G +++ KWMTBOMO11408 291 VKPLREIDIDDTEFACLKAIVFFDP--NAKGLSQPQKIKQLRYQIQINLEDYISDRQYDGRGRFGELLLCLPPLQSITWQMIEQIQFAKLFGVAHV 384 *********************..99*************************************************************** PP RXR-like 187 etlllemlessk 198 ++ll+eml+ + KWMTBOMO11408 385 DSLLQEMLLGGA 396 ******9865 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO11408

RXR-like

4.9e-61

6.6e-61

+ View

						  HMM length of domain: 202 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	205.6	0.0	6.6e-64	6.6e-61	1	198	202	396

  Alignments for each domain:
  == domain 1  score: 205.6 bits;  conditional E-value: 6.6e-64
       RXR-like   1 icetaarlLfllVewaksipafseLpledqviLLrasWaelliLalaqtsiplsdaqlllasglsvarnsaek..evekildle....evrvLqel 90 
                    +c++ +++L+ lVewak+ipaf+eL l+dqv+LLra++ e+l+L+ a++s++l+d  lll++++ +++++ ++  +      ++     +rv++e+
  KWMTBOMO11408 202 VCDSIKQQLLILVEWAKYIPAFTELHLDDQVALLRAHAGEHLLLGCARRSLHLKDI-LLLGNNCIITKHNIDGrmD------IDismiGMRVMDEI 290
                    8******************************************************9.9999999999987777442......22224588****** PP

       RXR-like  91 vtklrdlqldatEyacLkaIvlfnpdtdaagleerskieslrekvqasleeyiqdqypeqpgrFgklLlrLpalrsissktieelffskliGdtpi 186
                    v++lr++++d+tE+acLkaIv+f+p  +a+gl++++ki++lr + q +le+yi+d++++ +grFg+lLl Lp l+si++++ie+++f+kl+G +++
  KWMTBOMO11408 291 VKPLREIDIDDTEFACLKAIVFFDP--NAKGLSQPQKIKQLRYQIQINLEDYISDRQYDGRGRFGELLLCLPPLQSITWQMIEQIQFAKLFGVAHV 384
                    *************************..99******************************************************************* PP

       RXR-like 187 etlllemlessk 198
                    ++ll+eml+ + 
  KWMTBOMO11408 385 DSLLQEMLLGGA 396
                    ********9865 PP