Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
---|---|---|---|---|---|
KWMTBOMO10989 | MOZ_SAS | 9.8e-79 | 1e-73 | 2 | + View |
HMM length of domain: 179 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 246.7 0.3 2.4e-77 1e-73 1 149 308 462 2 15.1 0.1 3e-06 0.013 144 179 1652 1687 Alignments for each domain: == domain 1 score: 246.7 bits; conditional E-value: 2.4e-77 MOZ_SAS 1 ppGkeiYrkeklsvfevdGekeklycqnLcllaklFldhktlyydvepFlfYvlteadeegahivGyFskekesaeeynlaCilvlPpyqrkgyGk 96 ppG+eiYrk ++s+fe+dG+k+k y+qnLcllaklFldhktlyyd++pFlfYv+te d++g+hivGyFskekes+e+yn+aCil+lPpyqrkgyGk KWMTBOMO10989 308 PPGNEIYRKGSISFFEIDGRKNKCYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTLPPYQRKGYGK 403 8*********************************************************************************************** PP MOZ_SAS 97 lliefsYeLskregkigtPekPlsdlgllsyrsywkeeilellke......kekkkisi 149 lliefsYeLsk egk+g+PekPlsdlgllsyrsyw+++il++l + +ek i+i KWMTBOMO10989 404 LLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILDILLHikpvgdNEKPVITI 462 *****************************************998866665544444444 PP == domain 2 score: 15.1 bits; conditional E-value: 3e-06 MOZ_SAS 144 kkkisieeisektgikeeDiistleelkllkyekgk 179 ++ + +ei+e t+ik+eD+istl++l+l++y+kg+ KWMTBOMO10989 1652 LSTAEADEICELTSIKKEDVISTLQNLNLINYYKGQ 1687 45667899*************************986 PP |
渝公网安备 50010602502065号