Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO09428	TRAM_LAG1_CLN8	3e-38	5.3e-38	1	+ View
HMM length of domain: 198 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 130.7 11.0 1.6e-41 5.3e-38 1 196 91 308 Alignments for each domain: == domain 1 score: 130.7 bits; conditional E-value: 1.6e-41 TRAM_LAG1_CLN8 1 kfdervvslvqyllstvfglivlssspelwegyperilgathfllkayyllalgYfiydllvlllyekkrkdf...................... 73 ++++++vs+vq++ +++ g++v+s+s+ +++ a+h++++ay++++++Yf+yd++++++++ + KWMTBOMO09428 91 DINNKLVSAVQAVYCVATGVVVCSHSC------RRDFMRASHYMSEAYAWFGAAYFFYDIWSMYMVHIQMV-Sggesmkeqvrrrvserkapvsf 178 589**********************......899***************************9965.1567789999********* PP TRAM_LAG1_CLN8 74 .......vemliHhi.itlvllvlsyv..rnlgrvglvvlllhelsdpflnlrkilsylkkkskssklvlfngllfllsFfvcRlvllpylills 158 ++ l+Hh+ i+ +++++++ + lg++ ++ + +e+s+p++++r +l l+ k s l+l ngll+ll+F++cR++ lpy+++l+ KWMTBOMO09428 179 lkycahePVILLHHVfIGGFGFLVIVHlrGSLGDCAFGWVYGMEASTPLVCARGVLARLRLK--RSPLYLANGLLMLLTFLLCRVLSLPYVCWLY 271 ***********9999999999888999************************777..44788888**************88888 PP TRAM_LAG1_CLN8 159 ildvaklslstaplwlpliflilllvLqllnlyWfyli 196 +++ l +a+ lp ++ i++++L+l++lyWfyl+ KWMTBOMO09428 272 SRELG-LTYAQAIQSLPTGCKISICILLLPQLYWFYLM 308 88777.5667789**********************9 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO09428

TRAM_LAG1_CLN8

3e-38

5.3e-38

+ View

						  HMM length of domain: 198 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	130.7	11.0	1.6e-41	5.3e-38	1	196	91	308

  Alignments for each domain:
  == domain 1  score: 130.7 bits;  conditional E-value: 1.6e-41
  TRAM_LAG1_CLN8   1 kfdervvslvqyllstvfglivlssspelwegyperilgathfllkayyllalgYfiydllvlllyekkrkdf...................... 73 
                     ++++++vs+vq++ +++ g++v+s+s+        +++ a+h++++ay++++++Yf+yd++++++++ +                          
   KWMTBOMO09428  91 DINNKLVSAVQAVYCVATGVVVCSHSC------RRDFMRASHYMSEAYAWFGAAYFFYDIWSMYMVHIQMV-Sggesmkeqvrrrvserkapvsf 178
                     589************************......899*******************************9965.1567789999************* PP

  TRAM_LAG1_CLN8  74 .......vemliHhi.itlvllvlsyv..rnlgrvglvvlllhelsdpflnlrkilsylkkkskssklvlfngllfllsFfvcRlvllpylills 158
                            ++ l+Hh+ i+ +++++++   + lg++ ++  + +e+s+p++++r +l  l+ k   s l+l ngll+ll+F++cR++ lpy+++l+
   KWMTBOMO09428 179 lkycahePVILLHHVfIGGFGFLVIVHlrGSLGDCAFGWVYGMEASTPLVCARGVLARLRLK--RSPLYLANGLLMLLTFLLCRVLSLPYVCWLY 271
                     ***************9999999999888999****************************777..44788888******************88888 PP

  TRAM_LAG1_CLN8 159 ildvaklslstaplwlpliflilllvLqllnlyWfyli 196
                     +++   l   +a+  lp ++ i++++L+l++lyWfyl+
   KWMTBOMO09428 272 SRELG-LTYAQAIQSLPTGCKISICILLLPQLYWFYLM 308
                     88777.5667789************************9 PP