Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
---|---|---|---|---|---|
KWMTBOMO07464 | TRAM_LAG1_CLN8 | 5.6e-19 | 7.4e-18 | 2 | + View |
HMM length of domain: 198 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 64.9 21.0 2.2e-21 7.4e-18 1 181 37 207 2 4.2 0.3 0.009 30 2 22 194 218 Alignments for each domain: == domain 1 score: 64.9 bits; conditional E-value: 2.2e-21 TRAM_LAG1_CLN8 1 kfdervvslvqyllstvfglivlssspelwegyperilgathfllkayyllalgYfiydllvlllyekkrkdfvemliHhiitlvllvlsyv.rn 94 +++ r+v l++ +++tv+gl+ + + +p r + +t + +a++l ++gYf dll++++y+ +d+++ml+Hh+++lv +++ + + KWMTBOMO07464 37 EWCSRAVTLLHGSVATVVGLYQCGAEA----ITPCRLTMKTTPWHYALMLWSWGYFAFDLLWCFVYW---GDHYLMLVHHTSALVAVTVYTQkDY 124 6999*******************9997....5566666666666666******************77...578********77777776666477 PP TRAM_LAG1_CLN8 95 lgrvglvvlllhelsdpflnlrkilsylkkkskssklvlfngllfllsFfvcRlvllpylillsildvaklslstaplwlpliflil 181 g+ ++++l e+++p+l lr++l+ ++ +++l+ ++++++l++F+++R +l++y +++ + ++ + +l + ++++++ KWMTBOMO07464 125 TGCTFACTLAFLEVTNPLLQLRWFLKSN-GY-AKTVLYTMVEVTYLVTFLFVRGILGTYIMMRILKSDI-FDVDE-KLISLVFYIVS 207 78889999999*****************.66.455899999******************7766555443.34443.34444444444 PP == domain 2 score: 4.2 bits; conditional E-value: 0.009 TRAM_LAG1_CLN8 2 fdervvslvqyllstvfgl....iv 22 +de+++slv+y++s++f + +v KWMTBOMO07464 194 VDEKLISLVFYIVSVAFIYdivgYV 218 6889999999999999888544444 PP |
渝公网安备 50010602502065号