Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO07222	RXR-like	2.3e-51	3.4e-51	1	+ View
HMM length of domain: 202 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 173.8 0.0 3.4e-54 3.4e-51 2 199 249 438 Alignments for each domain: == domain 1 score: 173.8 bits; conditional E-value: 3.4e-54 RXR-like 2 cetaarlLfllVewaksipafseLpledqviLLrasWaelliLalaqtsiplsdaqlllasglsvarnsaek...evekildleevrvLqelvtkl 94 +et+arlLf++V+w++ f+ L+ +dq+ LLra+W++l++L+laq+s+p ++a+ll a ar + ++ + l e ++Lqe+++++ KWMTBOMO07222 249 QETSARLLFMAVRWVRCLAPFQALSPSDQLVLLRAAWKDLFLLHLAQWSAPWDLAPLLSAPA---AR---ARlppDPLADL---ELNTLQEILCRF 335 89***************************************************7777763...33...22223333322...579***** PP RXR-like 95 rdlqldatEyacLkaIvlfnpdtdaagleerskieslrekvqasleeyiqdqypeqpgrFgklLlrLpalrsissktieelffskliGdtpietll 190 r++ d E +c+kaIvlf+p d agl+e++ +e+l++++q+ l +y++++y qp+rFg+lLl+Lp+lr ++++ ie l f+ ++Gd++++tll KWMTBOMO07222 336 RQIAPDGSECGCMKAIVLFSP--DTAGLSETQPVEMLQDQAQCILADYVRTRYTRQPTRFGRLLLLLPSLRAVRARSIELLLFRDTVGDVSVTTLL 429 *****************..67******************************************************************* PP RXR-like 191 lemlesskp 199 ++m++++++ KWMTBOMO07222 430 HDMYRMQPA 438 ***9876 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO07222

RXR-like

2.3e-51

3.4e-51

+ View

						  HMM length of domain: 202 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	173.8	0.0	3.4e-54	3.4e-51	2	199	249	438

  Alignments for each domain:
  == domain 1  score: 173.8 bits;  conditional E-value: 3.4e-54
       RXR-like   2 cetaarlLfllVewaksipafseLpledqviLLrasWaelliLalaqtsiplsdaqlllasglsvarnsaek...evekildleevrvLqelvtkl 94 
                    +et+arlLf++V+w++    f+ L+ +dq+ LLra+W++l++L+laq+s+p ++a+ll a     ar   +    ++ + l   e ++Lqe+++++
  KWMTBOMO07222 249 QETSARLLFMAVRWVRCLAPFQALSPSDQLVLLRAAWKDLFLLHLAQWSAPWDLAPLLSAPA---AR---ARlppDPLADL---ELNTLQEILCRF 335
                    89*****************************************************7777763...33...22223333322...579********* PP

       RXR-like  95 rdlqldatEyacLkaIvlfnpdtdaagleerskieslrekvqasleeyiqdqypeqpgrFgklLlrLpalrsissktieelffskliGdtpietll 190
                    r++  d  E +c+kaIvlf+p  d agl+e++ +e+l++++q+ l +y++++y  qp+rFg+lLl+Lp+lr ++++ ie l f+ ++Gd++++tll
  KWMTBOMO07222 336 RQIAPDGSECGCMKAIVLFSP--DTAGLSETQPVEMLQDQAQCILADYVRTRYTRQPTRFGRLLLLLPSLRAVRARSIELLLFRDTVGDVSVTTLL 429
                    *********************..67*********************************************************************** PP

       RXR-like 191 lemlesskp 199
                    ++m++++++
  KWMTBOMO07222 430 HDMYRMQPA 438
                    *****9876 PP