Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO06982	RHD	2.5e-62	4e-62	1	+ View
HMM length of domain: 169 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 209.0 0.0 7e-66 4e-62 1 169 65 236 Alignments for each domain: == domain 1 score: 209.0 bits; conditional E-value: 7e-66 EEEEE-B-TTSE--EECCCTSSSS---BTT--SSS----EEEEES--SSEEEEEEEEESSST--B-SSEEESTT.EETTEEEE..EE-TTTSEEE- CS RHD 1 leIleqPkqrgfRfrYkcEgrsaGsipgessekskktfPtvkilnydgeakirvslvtkdeplrpHahslvgkd.ckdgvcev..elkpedmvasf 93 + I+eqP ++++RfrYkcEgrsaGs+pg ss+ ++kt+Pt+ki+ y+g+a+i+vs+v kd+p++pH+h+lvg++ c +gvc+v ++ +++ ++f KWMTBOMO06982 65 VVIVEQPASKALRFRYKCEGRSAGSLPGVSSTPENKTYPTIKICSYKGPATIVVSCVNKDPPFKPHPHNLVGRErCDRGVCSVrtDVTEDNNEYQF 160 57*********************************************************************889998335777899 PP SSEEEEE--CGGHHHHHHHHHHCT--TTS-TCGGCTSGGGS-TTEEEEEEEEEE-CSTTSCEEE---EEEEEEEES CS RHD 94 qnlGIlcvkkkeveealkerielkekeknvekeakeeakeidlnvvrlcFqaflpdstgnfttalepvvSnpiydk 169 +nlGI+cvk+k++ ++l+ r+el+++++++ +++++++++idln+vrl Fq+f+pd g+++++l+ vvS+ iydk KWMTBOMO06982 161 RNLGIQCVKRKDIVAELRLREELRVDPFRTGFDHRSHTQSIDLNAVRLAFQVFVPDGAGRMRRPLPAVVSDIIYDK 236 ************************************************************************96 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO06982

RHD

2.5e-62

4e-62

+ View

						  HMM length of domain: 169 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	209.0	0.0	7e-66	4e-62	1	169	65	236

  Alignments for each domain:
  == domain 1  score: 209.0 bits;  conditional E-value: 7e-66
                    EEEEE-B-TTSE--EECCCTSSSS---BTT--SSS----EEEEES--SSEEEEEEEEESSST--B-SSEEESTT.EETTEEEE..EE-TTTSEEE- CS
            RHD   1 leIleqPkqrgfRfrYkcEgrsaGsipgessekskktfPtvkilnydgeakirvslvtkdeplrpHahslvgkd.ckdgvcev..elkpedmvasf 93 
                    + I+eqP ++++RfrYkcEgrsaGs+pg ss+ ++kt+Pt+ki+ y+g+a+i+vs+v kd+p++pH+h+lvg++ c +gvc+v  ++ +++  ++f
  KWMTBOMO06982  65 VVIVEQPASKALRFRYKCEGRSAGSLPGVSSTPENKTYPTIKICSYKGPATIVVSCVNKDPPFKPHPHNLVGRErCDRGVCSVrtDVTEDNNEYQF 160
                    57***********************************************************************88****9998335777899**** PP

                    SSEEEEE--CGGHHHHHHHHHHCT--TTS-TCGGCTSGGGS-TTEEEEEEEEEE-CSTTSCEEE---EEEEEEEES CS
            RHD  94 qnlGIlcvkkkeveealkerielkekeknvekeakeeakeidlnvvrlcFqaflpdstgnfttalepvvSnpiydk 169
                    +nlGI+cvk+k++ ++l+ r+el+++++++ +++++++++idln+vrl Fq+f+pd  g+++++l+ vvS+ iydk
  KWMTBOMO06982 161 RNLGIQCVKRKDIVAELRLREELRVDPFRTGFDHRSHTQSIDLNAVRLAFQVFVPDGAGRMRRPLPAVVSDIIYDK 236
                    **************************************************************************96 PP