Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
---|---|---|---|---|---|
KWMTBOMO06125 | STAT | 1.8e-98 | 1.8e-98 | 2 | + View |
HMM length of domain: 248 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 0.7 0.1 0.022 3.7e+02 69 118 139 194 2 329.3 0.6 1.1e-102 1.8e-98 1 248 327 581 Alignments for each domain: == domain 1 score: 0.7 bits; conditional E-value: 0.022 STAT 69 eilnnekaleyqeetkqlsaefrnlsLkeikrserkga......esVteekfallF 118 + ++k ee ++l+a+++ lsL+ + ++kg+ ++Vt e+ l+ KWMTBOMO06125 139 LQTVRQKVNIAGEEIRSLQANIESLSLQYHECLKNKGHmnylqqQTVTTERRDLVA 194 44455666666788899*************99999998889999999988876665 PP == domain 2 score: 329.3 bits; conditional E-value: 1.1e-102 STAT 1 fvvekqPpqVlktqtkFsakvRlLvgdklqehlnslkvkvsiiseeqakallkgeskvleleesessgeilnnekaleyqeetkqlsaefrnlsLk 96 fv+ekqPpqV+kt+t+F+a+vRlLvg++l++ +++++v+v iise+qa+ llk+++++ + ++ ++g+ilnn++++eyq +++qls++frn++L+ KWMTBOMO06125 327 FVIEKQPPQVMKTNTRFTATVRLLVGGQLNVYMTPPRVSVVIISEQQAQLLLKSDTQAGKGKQPVECGDILNNTGTMEYQPTSRQLSVSFRNMQLR 422 9*********************************************************************************************** PP STAT 97 eikrserkgaesVteekfallFeteftl..gelkfkvetlSlPvvvivhgsQepsAwAtilWdnafaepkrlpffvpekvsWkqlaeaLswkFssa 190 +ikr+e+kg+esV++ek +llF+++f++ gel f+v+tlSlPvvvivhg+Qep++wAt++Wdnaf+ p r+pf+vp+kv+W qlae+Ls kFssa KWMTBOMO06125 423 KIKRAEKKGTESVMDEKLTLLFQSQFNVggGELVFQVWTLSLPVVVIVHGNQEPHGWATVTWDNAFSPPGRVPFAVPDKVTWGQLAETLSLKFSSA 518 ****************************999***************************************************************** PP STAT 191 tergLseeqlkyLaekllgkksske.....qklvswsqfskenlpgrnftfWeWfdgilelik 248 t+ Lse++l++Laek+++++ + + vsw+qf+k++lp+rnftfWeWf+ ++++++ KWMTBOMO06125 519 TGGSLSEDNLRFLAEKIFRTSLPLNtmelnAMAVSWTQFCKDALPERNFTFWEWFYMVVKVTR 581 *******************998777788999****************************9986 PP |
渝公网安备 50010602502065号