Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO05671	THR-like	5.4e-38	1.4e-37	2	+ View
HMM length of domain: 199 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 129.1 0.1 1e-40 1.4e-37 7 194 203 384 2 -2.6 0.0 2.2 3.2e+03 64 86 539 563 Alignments for each domain: == domain 1 score: 129.1 bits; conditional E-value: 1e-40 THR-like 7 lvekfaelstqaiqevveFaKkipgFseleqeDQitLLkgaclevmllrlargfnpesdtvtlndaelvtrdqlrslgrpglqgeliesvfkfaks 102 +f++++++ i+ v++Fa ipgF+ l+q+D+ tLLk++ ++++++rl +f+ + + +++l++rd+++s+ + l++s fkfa++ KWMTBOMO05671 203 SEKEFSQRFAHVIRGVIDFAGLIPGFQLLTQDDKFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGAN---ARFLVDSTFKFAER 295 55789999*********************************************876666655777*****986...67789***** PP THR-like 103 laslnlddeemaLlvavallsPadrpgvsnegkveklqegvlealevylqkrhpasndpdlfakLlgkltelRslneehserlvmlkveepk 194 ++s+nl+d+e+ L++a++l+ P drpg++n + ve++ ++ l++++ +++p ++p ++ L+ l++lR+l++ h+e+lv++++e+++ KWMTBOMO05671 296 MNSMNLTDAEIGLFCAIVLITP-DRPGLRNIELVERMHSRLKACLQTVIAQNRP--ERPGFLRELMDTLPDLRTLSTLHTEKLVVFRTEHKE 384 *****************9.***************************..57***************************99975 PP == domain 2 score: -2.6 bits; conditional E-value: 2.2 THR-like 64 sdtvtlndaelvtrdqlrslgr..p 86 + t+tl d++++ +++r+++r + KWMTBOMO05671 539 GGTSTLMDETYKPHKKFRAMRRdtG 563 5678888888888888888887643 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO05671

THR-like

5.4e-38

1.4e-37

+ View

						  HMM length of domain: 199 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	129.1	0.1	1e-40	1.4e-37	7	194	203	384
2	-2.6	0.0	2.2	3.2e+03	64	86	539	563

  Alignments for each domain:
  == domain 1  score: 129.1 bits;  conditional E-value: 1e-40
       THR-like   7 lvekfaelstqaiqevveFaKkipgFseleqeDQitLLkgaclevmllrlargfnpesdtvtlndaelvtrdqlrslgrpglqgeliesvfkfaks 102
                       +f++++++ i+ v++Fa  ipgF+ l+q+D+ tLLk++ ++++++rl  +f+   + +   +++l++rd+++s+ +      l++s fkfa++
  KWMTBOMO05671 203 SEKEFSQRFAHVIRGVIDFAGLIPGFQLLTQDDKFTLLKSGLFDALFVRLICMFDAPLNSIICLNGQLMKRDSIQSGAN---ARFLVDSTFKFAER 295
                    55789999***********************************************876666655777*********986...67789********* PP

       THR-like 103 laslnlddeemaLlvavallsPadrpgvsnegkveklqegvlealevylqkrhpasndpdlfakLlgkltelRslneehserlvmlkveepk 194
                    ++s+nl+d+e+ L++a++l+ P drpg++n + ve++  ++   l++++ +++p  ++p ++  L+  l++lR+l++ h+e+lv++++e+++
  KWMTBOMO05671 296 MNSMNLTDAEIGLFCAIVLITP-DRPGLRNIELVERMHSRLKACLQTVIAQNRP--ERPGFLRELMDTLPDLRTLSTLHTEKLVVFRTEHKE 384
                    *********************9.*******************************..57*****************************99975 PP

  == domain 2  score: -2.6 bits;  conditional E-value: 2.2
       THR-like  64 sdtvtlndaelvtrdqlrslgr..p 86 
                    + t+tl d++++  +++r+++r  +
  KWMTBOMO05671 539 GGTSTLMDETYKPHKKFRAMRRdtG 563
                    5678888888888888888887643 PP