HMM length of domain: 104 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	80.7	8.3	4.9e-27	8.3e-23	1	97	3	96
2	0.4	3.0	0.047	8e+02	74	94	191	211

  Alignments for each domain:
  == domain 1  score: 80.7 bits;  conditional E-value: 4.9e-27
          TIP_N  1 ddemerfeitdydldnefnykrrrrrqtKeeaiYGvFaedDsddeeeerrskkrsrrgkkdytkpvnFvsggikkeakedkekddkkdeeeeeeeee 97
                   dde+ +feitdydldnefn+ r r +  Ke++iYGv+a +Dsdd+e+e + ++r r+  kd+++p+ Fv+gg+++++k+++++++ k  e +++  +
  KWMTBOMO04041  3 DDEVIKFEITDYDLDNEFNPGRGR-KANKEQQIYGVWA-KDSDDDENEDNVRQRIRKP-KDFSAPIGFVAGGVQQAGKKKDKTKEIKPAEASTSAPK 96
                   89999*****************99.999**********.5**9988888887665555.6**************99887776665544444444333 PP

  == domain 2  score: 0.4 bits;  conditional E-value: 0.047
          TIP_N  74 kkeakedkekddkkdeeeeee 94 
                    k++++e+  ++dk+d++++++
  KWMTBOMO04041 191 KAKKEEERRIKDKEDQDKDKT 211
                    333333333333333333322 PP