Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO03119	Nrf1	4.4e-111	5.9e-111	1	+ View
HMM length of domain: 212 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 369.2 0.0 6.9e-115 5.9e-111 3 211 83 291 Alignments for each domain: == domain 1 score: 369.2 bits; conditional E-value: 6.9e-115 Nrf1 3 vGvaaaaaiatgkkrkrphsfetnpsirkrqqtrLlrklkatldeyttRvGqqavvlvvtPskpnsvfkvfGakpLeavvknlksvileeleeala 98 G+aaaaaia++kkrkrphsfetnps+rkr+q+rLlrkl++t++e++tRvGqqavvlv tP+kpn++++vfGakpLe+vv+nl+ +i+eele+ala KWMTBOMO03119 83 AGMAAAAAIASSKKRKRPHSFETNPSVRKRHQNRLLRKLRQTIEEFATRVGQQAVVLVATPGKPNTSYRVFGAKPLEDVVRNLRCMIMEELENALA 178 7********************************************************************************************* PP Nrf1 99 eqapkqekeksellelPplvidgiptpvekmtqaqlrlfipemlkystgrgkpgWGkeslkpvwwPkdlpwanvrsdvrseeekkkvsWteaLRki 194 +qap+ ++ +l+elPpl+idgiptpvekmtqaqlr+fip+mlkys rgkpgWG+es++p+wwPkdlpwanvr+d+rse+ek+k+sWt+aLR+i KWMTBOMO03119 179 QQAPPPPADDPSLFELPPLIIDGIPTPVEKMTQAQLRAFIPLMLKYSMVRGKPGWGRESTRPPWWPKDLPWANVRMDARSEDEKQKMSWTHALRQI 274 ******************************************************************************************** PP Nrf1 195 vknCYkyhgReDLleaf 211 v+nCYkyhgReDLl+af KWMTBOMO03119 275 VINCYKYHGREDLLPAF 291 *************99 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO03119

Nrf1

4.4e-111

5.9e-111

+ View

						  HMM length of domain: 212 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	369.2	0.0	6.9e-115	5.9e-111	3	211	83	291

  Alignments for each domain:
  == domain 1  score: 369.2 bits;  conditional E-value: 6.9e-115
           Nrf1   3 vGvaaaaaiatgkkrkrphsfetnpsirkrqqtrLlrklkatldeyttRvGqqavvlvvtPskpnsvfkvfGakpLeavvknlksvileeleeala 98 
                     G+aaaaaia++kkrkrphsfetnps+rkr+q+rLlrkl++t++e++tRvGqqavvlv tP+kpn++++vfGakpLe+vv+nl+ +i+eele+ala
  KWMTBOMO03119  83 AGMAAAAAIASSKKRKRPHSFETNPSVRKRHQNRLLRKLRQTIEEFATRVGQQAVVLVATPGKPNTSYRVFGAKPLEDVVRNLRCMIMEELENALA 178
                    7*********************************************************************************************** PP

           Nrf1  99 eqapkqekeksellelPplvidgiptpvekmtqaqlrlfipemlkystgrgkpgWGkeslkpvwwPkdlpwanvrsdvrseeekkkvsWteaLRki 194
                    +qap+   ++ +l+elPpl+idgiptpvekmtqaqlr+fip+mlkys  rgkpgWG+es++p+wwPkdlpwanvr+d+rse+ek+k+sWt+aLR+i
  KWMTBOMO03119 179 QQAPPPPADDPSLFELPPLIIDGIPTPVEKMTQAQLRAFIPLMLKYSMVRGKPGWGRESTRPPWWPKDLPWANVRMDARSEDEKQKMSWTHALRQI 274
                    ************************************************************************************************ PP

           Nrf1 195 vknCYkyhgReDLleaf 211
                    v+nCYkyhgReDLl+af
  KWMTBOMO03119 275 VINCYKYHGREDLLPAF 291
                    ***************99 PP