Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
---|---|---|---|---|---|
KWMTBOMO02188 | CSRNP_N | 1.4e-94 | 1.4e-94 | 4 | + View |
HMM length of domain: 219 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 -2.6 3.2 0.47 4e+03 54 111 30 88 2 316.0 6.1 1.7e-98 1.4e-94 1 219 214 423 3 -3.9 0.1 1.2 9.9e+03 39 62 443 466 4 -2.1 1.4 0.34 2.8e+03 83 113 659 691 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.47 CSRNP_N 54 qkrlrreklrerlkeeklealklk.lsssdlleeeeeealevddisdedldseaelddy 111 q++++ e+ + e+++++ +++ ss+ +++ + +++ ++sd+ +d ++dd KWMTBOMO02188 30 QTSSKTETFPVLRDEKSCDSDTHSeDLSSNDEQNNANGNSHFYESSDSKIDYAVKIDDN 88 44444444444444444443333312222223333334456666777777766666655 PP == domain 2 score: 316.0 bits; conditional E-value: 1.7e-98 CSRNP_N 1 kkkksvkFdkvtvyyFpRlqgftsvPsqGGstLGmakkhsslkkftlaehaieqkrlrreklrerlkeeklealklklsssdlleeeeeealevdd 96 k+k+ ++Fd+vtv+yFpR+qgf++vPsqGGstLGm+ +hs+++kftlaeha eq+rl+r+ l++ ++e+++ + + l ss++ +++eee ++d KWMTBOMO02188 214 KRKEGIRFDNVTVFYFPRAQGFSCVPSQGGSTLGMEWEHSHIQKFTLAEHALEQRRLHRQILQQLKSERNSLKGD--LLSSSEDSDTEEE---ASD 304 57899***********************************************************99998776555..4555545565655...457 PP CSRNP_N 97 isdedldseaelddylflqplstkkrralLraaGvkkidseekkelraiRksRekCGCdCkgvCdPetCaCslagikCqvDrasFPCgCtkdgCgn 192 is+++ld ld+y+flqp++t++rralLraaGv+ki+ ek+e+r+iR+sRe CGC+Ckg C+Pe+C+CslagikCqvDr +FPCgCt+dgCgn KWMTBOMO02188 305 ISESELD----LDNYYFLQPVPTRQRRALLRAAGVRKIEGYEKDECRDIRTSREFCGCACKGSCNPENCSCSLAGIKCQVDRLNFPCGCTRDGCGN 396 899***9....************************************************************************************* PP CSRNP_N 193 tegriefnsvrvrthflhtlmrlelek 219 t+griefn+vrvrthf++tlmr+ lek KWMTBOMO02188 397 TTGRIEFNPVRVRTHFIQTLMRIGLEK 423 ***********************9986 PP == domain 3 score: -3.9 bits; conditional E-value: 1.2 CSRNP_N 39 hsslkkftlaehaieqkrlrrekl 62 h+++ + l++h +e++r+ r++ KWMTBOMO02188 443 HNASTNGCLTNHLYERERCLRQED 466 666667777777777776666543 PP == domain 4 score: -2.1 bits; conditional E-value: 0.34 CSRNP_N 83 lleeeeeealevddisdedld..seaelddylf 113 + ++++++ ++ + + + ++ ++d+ +f KWMTBOMO02188 659 AESKTDSHYTTLTTMPYQSNNklQTVDNDQNWF 691 222222222222221111111112333333333 PP |
渝公网安备 50010602502065号