Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO00829	THR-like	1.2e-37	2.2e-37	1	+ View
HMM length of domain: 199 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 128.4 0.0 1.6e-40 2.2e-37 5 198 507 698 Alignments for each domain: == domain 1 score: 128.4 bits; conditional E-value: 1.6e-40 THR-like 5 qslvekfaelstqaiqevveFaKkipgFseleqeDQitLLkgaclevmllrlargfnpesdtvtlndaelvtrdqlrslgrpglqgeliesvfkfa 100 +++++++a+++t +iq+++eFaK ipgF++l+q+DQi+LLk++++e+ ++rl+r+ + +d v + d l r+++++ + p l++ +f++a KWMTBOMO00829 507 EEMWLDCADKLTAMIQNIIEFAKLIPGFMKLTQDDQILLLKSGSFELAIVRLSRLIDVNRDQVLYGDVVLPVRECVHARD-P-RDVALVQGIFEAA 600 79*************************************************************************988.5.6789***** PP THR-like 101 kslaslnlddeemaLlvavallsPadrpgvsnegkveklqegvlealevylqkrhpas.ndpdlfakLlgkltelRslneehserlvmlkveepkt 195 ks+a l+l+++e+aL++ ++ll+P +r gv + ++ l ++ ++a ++ ++ +h + d ++ Ll+k+++ R l+ +h l+ +k ++p+ KWMTBOMO00829 601 KSIARLKLTETELALYQSLVLLWP-ERHGVMGNSEIRCLFNMSMSAMRHEIEVNHAPLkGDVTVLDTLLAKIPTFRDLSLMHLGALSRFKATHPHH 695 *******************9.**************************97678999****************************988 PP THR-like 196 slp 198 ++p KWMTBOMO00829 696 VFP 698 776 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO00829

THR-like

1.2e-37

2.2e-37

+ View

						  HMM length of domain: 199 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	128.4	0.0	1.6e-40	2.2e-37	5	198	507	698

  Alignments for each domain:
  == domain 1  score: 128.4 bits;  conditional E-value: 1.6e-40
       THR-like   5 qslvekfaelstqaiqevveFaKkipgFseleqeDQitLLkgaclevmllrlargfnpesdtvtlndaelvtrdqlrslgrpglqgeliesvfkfa 100
                    +++++++a+++t +iq+++eFaK ipgF++l+q+DQi+LLk++++e+ ++rl+r+ +  +d v + d  l  r+++++ + p     l++ +f++a
  KWMTBOMO00829 507 EEMWLDCADKLTAMIQNIIEFAKLIPGFMKLTQDDQILLLKSGSFELAIVRLSRLIDVNRDQVLYGDVVLPVRECVHARD-P-RDVALVQGIFEAA 600
                    79***************************************************************************988.5.6789********* PP

       THR-like 101 kslaslnlddeemaLlvavallsPadrpgvsnegkveklqegvlealevylqkrhpas.ndpdlfakLlgkltelRslneehserlvmlkveepkt 195
                    ks+a l+l+++e+aL++ ++ll+P +r gv  + ++  l ++ ++a ++ ++ +h +   d  ++  Ll+k+++ R l+ +h   l+ +k ++p+ 
  KWMTBOMO00829 601 KSIARLKLTETELALYQSLVLLWP-ERHGVMGNSEIRCLFNMSMSAMRHEIEVNHAPLkGDVTVLDTLLAKIPTFRDLSLMHLGALSRFKATHPHH 695
                    ***********************9.******************************97678999******************************988 PP

       THR-like 196 slp 198
                    ++p
  KWMTBOMO00829 696 VFP 698
                    776 PP