Gene | Transcription Factor Family | Full Seq Evalue | Best Domain Evalue | Domain Number | Alignment Detail |
---|---|---|---|---|---|
KWMTBOMO00379 | SF-like | 1e-83 | 1.6e-82 | 1 | + View |
HMM length of domain: 411 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 278.1 11.3 1.1e-85 1.6e-82 1 408 154 528 Alignments for each domain: == domain 1 score: 278.1 bits; conditional E-value: 1.1e-85 SF-like 1 AVRaDRmRGGRnkFgplYkrdralkqqkkam.katiranavkleasq.altlaqppeltvssalsdsssaasyedltkssllpssteqslsvsesl 94 AVRaDRmRGGRnkFgp+Ykrdra+k q m + +i+++ + + l+l +++t +s+ ++++ ++ + +++ ++ +s + l +++ KWMTBOMO00379 154 AVRADRMRGGRNKFGPMYKRDRARKLQM--MrQRQIAVQTLRGSLGDgGLVLGFGSPYTAVSVKQEIQIPQVSSLTSS-PE-SSPGPALLGAQPQP 245 9**************************9..8899*******9987641566666777776666655554443333333.22.22233333333333 PP SF-like 95 srsvppllretlpaayqyeefdlssraikseypdsytsnttnaatlspestvgstysestslsssttgreasstvpiLilellklekdedqvknki 190 ++ pp p + ++e +++ +s pd++t t +s + t+s+ + +s+ ++ v+++i e++++ d + +n + KWMTBOMO00379 246 PQPPPP------PTHDKWE-----AHSPHSASPDAFTFDT--------QSNTAATPSSTAEATSTE-----TLRVSPMIREFVQTV-DDREWQNAL 316 333333......4445665.....44557899***99933........333334444444444444.....589999******996.66789**** PP SF-like 191 lAklqqeqasrkktekpekfallckvAdqtLfsiVeWAkssqlFkeLkvdDQmkLLqnsWsellildhiarqvkhgkegsiklvtGqevelstvls 286 + lq ++ ++ + f l+ckv dq+Lfs V+WA++ ++Fk LkvdDQmkLLq+sWs +l+ldh+ + ++ g++++ l +Gq+++ +l KWMTBOMO00379 317 FGLLQSQTYNQ---CEVDLFELMCKVLDQNLFSQVDWARNTVFFKYLKVDDQMKLLQDSWSVMLVLDHLHQRMHNGLPDETTLHNGQKFD---LLC 406 **888776666...679*************************************************************************...777 PP SF-like 287 qagltlqtlvsraqdlvkrLrsLqldrrefvclkfLvLfdsdvkllenaleveevqekvnaalleYtlanypqcpdkfeqlllrlpevralssqae 382 +l++ +l + ++l ++L +L++d +++c kf+ L++++v+ + n + v+e ++ v+aall+Ytl yp dkf++l++ +pe+ al + e KWMTBOMO00379 407 LGLLGVPSLADHFNELQNKLAELKFDVPDYICVKFMLLLNPEVRGIVNVKCVREGYQTVQAALLDYTLTCYPTIQDKFGKLVMVVPEIHALAARGE 502 78899******************************************************************************************* PP SF-like 383 eylaykhlegevpvnnLliellqAkr 408 e l+++h g+ p + Ll+e+l+Akr KWMTBOMO00379 503 EHLYQRHCAGQAPTQTLLMEMLHAKR 528 *************************8 PP |
渝公网安备 50010602502065号