SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16482
Pre Gene Modal
BGIBMGA002210
Annotation
PREDICTED:_uncharacterized_protein_LOC101737771_isoform_X3_[Bombyx_mori]
Transcription factor
Location in the cell
Nuclear   Reliability : 4.045
 

Sequence

CDS
ATGCCTGATACTCATCGTACTTGTGAAGTTTGTGGTATCAAAGAAAGACATCTTAATGAAAAACGGTTTTTCGCAAGGTTTCCTCTGGATGTCAATAGATGTAAAGAGTGGGTAAAAATAGTTGGCAAAGAAGATCTGGCTTATCTCCAAGTACATATGCTACATGATTTAAAACATGTTTGTGAAGTACATTTCTCAAGGCGAGACTTTACAAAATCAAAGAAGCGCTTAAAAAAACGAGCTGTACCCAAACTGAACTTGACACCGCCACCATTGAGAGATGAAATTCTTTTTCAATTTTTGCAACTTAACTCACAAGCGGATGTCACCCCACAAGGCCAGTTTGAGGTTCAGGCCGTTCCTAGTGATTCAATGCCAGCATCCTCAAGTCAGCATAGCAGTCTAGAGAAAATGGATGTCACCCCACAAGGCCAGTTTGAGGTTCAGGCTGTTCCTAGTGCTTCAATGCCGACATCCTCAAGTCAGTCTAGCAGTCTAGAGAAAAACGTCACCACACGAAGCCAGCAGAAGGAAAGTGAAAGTCAAATAAGAAAAAGAAAATTAGAAGATGTTGATGTAACACCACGGAAAAGGAAGCTCTTAAGTGAATTGAGAAAAACAAAGTGCACATTGGCATCATTAAAAAAGAGCGCGAAACTAATAGACAATTTATCGTCAGAATTTCTAAAAGAAATTGTCACATCCGCGTTGAAAAATCAAAAGCGTAAGTCACAAGGTAAACGATGGACTATTAAAAATAAAATATCAGCATTAGCCATCTTCAAGCGTTCACCAAAAGCTTACCGATATTTGCGATATCTCGCACCATTTCCGAGTATCAAAACAATGCAAAAATTAATGACAAAAATACCTGTTGAGCCAGATTTAAATACAGCTGTACTTGACTACCTGAAAAAACTAGCTCCCATTAAAAAAATAAGAGCAAAATTATGCTCGGTAGTCTTTAACGAAATAGCGTTAAAAGAAAGATTAACTTATAGTGAAGCCACAGATAAAGTGGAAGGATTTATCGATTATGGATATGAGAGGAAAAATGAGCTAGCAAACCATGCCTTAGTCTTCATGTTATAA
Protein
MPDTHRTCEVCGIKERHLNEKRFFARFPLDVNRCKEWVKIVGKEDLAYLQVHMLHDLKHVCEVHFSRRDFTKSKKRLKKRAVPKLNLTPPPLRDEILFQFLQLNSQADVTPQGQFEVQAVPSDSMPASSSQHSSLEKMDVTPQGQFEVQAVPSASMPTSSSQSSSLEKNVTTRSQQKESESQIRKRKLEDVDVTPRKRKLLSELRKTKCTLASLKKSAKLIDNLSSEFLKEIVTSALKNQKRKSQGKRWTIKNKISALAIFKRSPKAYRYLRYLAPFPSIKTMQKLMTKIPVEPDLNTAVLDYLKKLAPIKKIRAKLCSVVFNEIALKERLTYSEATDKVEGFIDYGYERKNELANHALVFML

Summary

Pfam
PF05485   THAP        + More
PF12017   Tnp_P_element
PF14291   DUF4371
PF05699   Dimer_Tnp_hAT
PF04937   DUF659
PF03564   DUF1759
PF04727   ELMO_CED12
PF05585   DUF1758
Interpro
IPR006612   THAP_Znf        + More
IPR021896   Transposase_37       
IPR038441   THAP_Znf_sf       
IPR025398   DUF4371       
IPR012337   RNaseH-like_sf       
IPR008906   HATC_C_dom       
IPR007021   DUF659       
IPR006816   ELMO_dom       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR021109   Peptidase_aspartic_dom_sf       
IPR008737   Peptidase_asp_put       
IPR005312   DUF1759       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
Gene 3D
PDB
2D8R     E-value=0.00415955,     Score=94

Ontologies

Topology

Length:
363
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0002
Exp number, first 60 AAs:
0
Total prob of N-in:
0.03104
outside
1  -  363
 
 

Population Genetic Test Statistics

Pi
5.142742
Theta
15.345295
Tajima's D
-2.022634
CLR
1.81306
CSRT
0.0115994200289985
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号