Pre Gene Modal
BGIBMGA004983
Annotation
Lipopolysaccharide-induced_tumor_necrosis_factor-alpha_factor-like_protein_[Operophtera_brumata]
Full name
Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
Alternative Name
Small integral membrane protein of lysosome/late endosome
Estrogen-enhanced transcript protein 1
Location in the cell
Extracellular Reliability : 2.662
Sequence
CDS
ATGTCTACCCATCAAGGACCTAGTGCGCCACTAGACGATCTTCCACCGCCGTACTCATCGGTTGTAGGAACTACGCATTATGGCTTTGTGGCTCCGGCACTAAGTAATCCTATCCCGGATTCTGTAGGAGCATATCCACCTGCTAAACCATTTACTCCTCCAGGAGTTTACCCCCATCCCGAAGGTGTAACAAATGCAACTGTAAATATGCAGCCTTCTAGAATACCACCTCCACCACCAGGCTTACCAGTCGGTATTGTTCTTCCAAACGCTATGGGTACAGAACCAACCACTTTAACATGTTTCAACTGTAATAAAATAGTTACTACAAGAGTTACATACACAACAGCTTGGCACACACATTTAATTGCTGGGTCGATTTGCTTGATCACTATAGTTTGTTCACTATGCTGCCTGGGTTTGATCCCGTACTGCTTTGATACATTCAAGGAGGCTGAGCACTACTGCCCTAATTGCAACACATTCATCGGCAAAAGCAACAAGTGTTAA
Protein
MSTHQGPSAPLDDLPPPYSSVVGTTHYGFVAPALSNPIPDSVGAYPPAKPFTPPGVYPHPEGVTNATVNMQPSRIPPPPPGLPVGIVLPNAMGTEPTTLTCFNCNKIVTTRVTYTTAWHTHLIAGSICLITIVCSLCCLGLIPYCFDTFKEAEHYCPNCNTFIGKSNKC
Summary
Description
Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role in the nucleus in regulating the expression of numerous cytokines.
Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps downregulate downstream signaling cascades. Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4. May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines. May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10.
Subunit
Monomer. Interacts with NEDD4. Interacts (via PSAP motif) with TSG101, a component of the ESCRT-I complex (endosomal sorting complex required for transport I). Interacts with WWOX. Interacts with STAM, a component of the ESCRT-0 complex; the interaction is direct. Identified in a complex with STAM and HGS; within this complex, interacts directly with STAM, but not with HGS. Interacts with STAT6.
Similarity
Belongs to the CDIP1/LITAF family.
Keywords
Cell membrane
Complete proteome
Cytoplasm
DNA-binding
Endosome
Golgi apparatus
Lysosome
Membrane
Metal-binding
Nucleus
Reference proteome
Transcription
Transcription regulation
Zinc
Feature
chain Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
Ontologies
Topology
Subcellular location
Cytoplasm
Associated with membranes of lysosomes, early and late endosomes. Can translocate from the cytoplasm into the nucleus (By similarity). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity). With evidence from 1 publications.
Nucleus
Associated with membranes of lysosomes, early and late endosomes. Can translocate from the cytoplasm into the nucleus (By similarity). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity). With evidence from 1 publications.
Lysosome membrane
Associated with membranes of lysosomes, early and late endosomes. Can translocate from the cytoplasm into the nucleus (By similarity). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity). With evidence from 1 publications.
Early endosome membrane
Associated with membranes of lysosomes, early and late endosomes. Can translocate from the cytoplasm into the nucleus (By similarity). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity). With evidence from 1 publications.
Late endosome membrane
Associated with membranes of lysosomes, early and late endosomes. Can translocate from the cytoplasm into the nucleus (By similarity). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity). With evidence from 1 publications.
Endosome membrane
Associated with membranes of lysosomes, early and late endosomes. Can translocate from the cytoplasm into the nucleus (By similarity). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity). With evidence from 1 publications.
Cell membrane
Associated with membranes of lysosomes, early and late endosomes. Can translocate from the cytoplasm into the nucleus (By similarity). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity). With evidence from 1 publications.
Golgi apparatus membrane
Associated with membranes of lysosomes, early and late endosomes. Can translocate from the cytoplasm into the nucleus (By similarity). Detected at Schmidt-Lanterman incisures and in nodal regions of myelinating Schwann cells (By similarity). With evidence from 1 publications.
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
23.28057
Exp number, first 60 AAs:
0.16665
Total prob of N-in:
0.56753
Population Genetic Test Statistics