SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO10151  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA005634
Annotation
PREDICTED:_protein_shuttle_craft_[Bombyx_mori]
Full name
Protein shuttle craft      
Transcription factor
Location in the cell
Extracellular   Reliability : 2.664
 

Sequence

CDS
ATGTGCAGCAGCAAGCTACCGCAAGTGTGCGGGCGTCCTTGCCAACGCATGCTACAGTGCGGCGTACACAAATGCATGAAGGAATGCCACGAGGGTCCCTGTGAAGACTGCACCGAGTCTGTTACACAAGTGTGCCATTGCCCGCTGGCGAAGACTCGTGAGGTCCCATGCCGCGTGGAGTCGTCGTGGTCGTGCGGCGGCGCGTGCGGGCGCGTGCTGTCGTGCGGCGCGCACGTGTGCCGGAGCACGTGCCACGAGCCCCCCTGCCCCCCCTGCGACCTGCTGCCTGCCGCGCTCATCACATGTCCGTGCGGGAAGACTAGGTTAGTGTTATAA
Protein
MCSSKLPQVCGRPCQRMLQCGVHKCMKECHEGPCEDCTESVTQVCHCPLAKTREVPCRVESSWSCGGACGRVLSCGAHVCRSTCHEPPCPPCDLLPAALITCPCGKTRLVL

Summary

Similarity
Belongs to the NFX1 family.
Keywords
Alternative splicing   Complete proteome   DNA-binding   Metal-binding   Nucleus   Phosphoprotein   Reference proteome   Repeat   RNA-binding   Transcription   Transcription regulation   Zinc   Zinc-finger  
Feature
chain  Protein shuttle craft
splice variant  In isoform B.
EMBL
BABH01020191    BABH01020192    NWSH01000227    PCG78213.1    PCG78214.1    KQ459232    + More
KPJ02641.1    KQ461155    KPJ08291.1    KC469893    AGC92703.2    RSAL01000090    RVE48091.1    ODYU01001380    SOQ37468.1    AGBW02013517    OWR43279.1    FP102340    CBH09293.1    FR799575    CBZ26973.1    FR799609    CBZ34040.1    FR796454    UINB01000022    CBZ08650.1    SUZ41696.1    CP029521    AYU78699.1    JH431388    KQ971343    KYB27326.1    EFA04758.2    FR796418    CAJ03782.1    NEVH01014379    PNF27625.1    PNF27624.1    GL732581    EFX74683.1    MKGL01000327    RNF00413.1    BT125955    ADX35934.1    U09306    AE014134    AF145679    AUPL01006715    ESL05628.1    AGB92995.1    AGB92996.1    CH963913    EDW77484.2    JR046058    AEY60122.1    PRFC01000577    PWU85996.1    AAHK01000795    EAN89027.1    KK107064    EZA60846.1    NBCO01000019    ORC87859.1    AYLP01000076    ESS64932.1    PRFA01000142    MKKV01000219    PWU85837.1    RNF12979.1    PRFC01000083    MKQG01002482    PWV09102.1    RNC44062.1    AAHK01000050    EAN98570.1    AHKC01022676    EKF26023.1    AXCM01000660    GALX01003148    JAB65318.1    CH902620    EDV31856.1    GDIQ01210183    JAK41542.1    GDIP01115026    JAL88688.1    GDIQ01070236    JAN24501.1    GDIQ01191536    JAK60189.1    LS997621    SYZ65832.1    FR798997    CAM45049.2    GDIP01116421    JAL87293.1    CP009391    AIN98301.1    GDIQ01135765    JAL15961.1    CM000157    EDW89773.1    CH379058    EAL34416.2    CH479184    EDW37055.1    GEZM01096724    JAV54622.1    GDIP01055985    JAM47730.1    MCGO01000012    ORY48177.1    CH933807    EDW11771.1    GDIQ01172193    JAK79532.1    LFYR01001054    KMZ65305.1    JRES01000305    KNC32491.1    GDIP01191112    JAJ32290.1    PQIB02000018    RLM56259.1    GDIQ01119112    JAL32614.1    LGTL01000006    KPA81944.1    UXUI01007208    VDD86277.1    GDIP01206262    JAJ17140.1    GGLE01005607    MBY09733.1    GDIQ01102271    JAL49455.1    GDIQ01254719    JAJ97005.1    GDIP01074037    JAM29678.1    GDIP01067825    JAM35890.1    CH480818    EDW51806.1    GDIQ01128831    JAL22895.1    FN668640    CBK20994.2    CH954177    EDV58003.1    CM000361    EDX05105.1    PYGN01000208    PSN51156.1    KQ414614    KOC68840.1    GDIP01047087    JAM56628.1    GDIP01208014    JAJ15388.1    GDIP01207964    JAJ15438.1    GDIQ01004668    JAN90069.1    GDIP01139280    JAL64434.1    AGNK02002331    CM003531    RCV21105.1    CM002910    KMY90343.1    LRGB01001005    KZS14152.1    GDIP01206263    JAJ17139.1    GDIP01158477    JAJ64925.1   
Pfam
PF01424   R3H        + More
PF01422   zf-NF-X1
Interpro
IPR034076   R3H_NF-X1        + More
IPR034078   NFX1_fam       
IPR001374   R3H_dom       
IPR019787   Znf_PHD-finger       
IPR036867   R3H_dom_sf       
IPR019786   Zinc_finger_PHD-type_CS       
IPR001841   Znf_RING       
IPR000967   Znf_NFX1       
IPR011011   Znf_FYVE_PHD       
SUPFAM
SSF82708   SSF82708        + More
SSF57903   SSF57903       
Gene 3D

Ontologies

Topology

Subcellular location
Nucleus  
Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.23314
outside
1  -  111
 
 

Population Genetic Test Statistics

Pi
133.108066
Theta
122.960012
Tajima's D
0.366195
CLR
0
CSRT
0.474076296185191
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号