SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO02985
Pre Gene Modal
BGIBMGA003622
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_dynein_beta_chain?_ciliary-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.586 Nuclear   Reliability : 1.008
 

Sequence

CDS
ATGGCGTACGTTCATACCTCAGTGAACACAGTGTCTAAAGCATATTTGGCAAATGAAAGAAGATATAATTACACGACTCCCAAAAGTTATCTTGAACAGATAAGTCTCTACGCTAAACTGGTTCATCAAAAAACCGATGAACTGCAAGCTAAAATTACTCGGCTAGAAAACGGTCTAGAAAAACTTCGGAGCACAGCGAGTCAAGTAGACGAGCTGAAAGCTAAACTAGCAATACAAGAAATTGAATTGCAACAGAAAAACGAAGCGGCTGATAAACTCATAGAAATGGTTGGTGTGGAGACCGCGAAGGTACAAAGTGAAAAAGGGCTAGCTGACGAAGAAGAAGAAAAAGTAGCAGTAATAGCAGAGGAAGTATTAAAGAAGCAGAAAGATTGCGAAGAAGACTTGATTAAAGCAGAACCAGCGCTGGTGGCAGCTCAAGAAGCTTTGAACACTCTTAACAAAGCTAATCTGACCGAGCTGAAGTCGTTCGGTTCGCCTCCCGGCGCTGTGACTAATGTTACTGCTGCTGTAATGGTGTTGTTGGCTCCCGGAGGGAAAATACCTAAGGACAGGAGCTGGAAAGCTGCCAAGGTACATGATAAATCATAA
Protein
MAYVHTSVNTVSKAYLANERRYNYTTPKSYLEQISLYAKLVHQKTDELQAKITRLENGLEKLRSTASQVDELKAKLAIQEIELQQKNEAADKLIEMVGVETAKVQSEKGLADEEEEKVAVIAEEVLKKQKDCEEDLIKAEPALVAAQEALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLAPGGKIPKDRSWKAAKVHDKS

Summary

EMBL
BABH01007454    BABH01007455    BABH01007456    BABH01007457    AGBW02007827    OWR54500.1    + More
KQ461187    KPJ07329.1    ODYU01012953    SOQ59508.1    NWSH01001294    PCG71814.1    JRES01001345    KNC23525.1    CH916373    EDV94871.1    CVRI01000047    CRK98041.1    OUUW01000007    SPP83382.1    JXJN01012383    PYGN01000422    PSN46658.1    CM000070    EAL29221.2    KRT01415.1    AF494076    AAQ06635.1    CH933806    EDW16045.2    CH479185    EDW38589.1    CCAG010011423    CP012526    ALC46327.1    AJVK01064446    CH964232    KRF99495.1    EDW81616.1    CH902617    KPU80296.1    EDV43507.1    JXUM01075435    KQ562886    KXJ74924.1    CH477538    EAT39332.1    CH940652    EDW59661.2    CH480853    EDW51630.1    CM000160    KRK03004.1    KRK03003.1    KRK03002.1    AE014297    AGB96173.1    CH954181    EDV48312.1    AAF55834.3    KRK03001.1    EDW96208.2    DS232111    EDS35091.1    KQ971307    EFA11309.2    KYB29781.1    GL767121    EFZ14108.1    AXCN02001753    GGFL01015101    MBW79279.1    GGFK01000870    MBW34191.1    ADMH02002126    ETN58641.1    APCN01005160    AAAB01008849    EAL41019.3    KQ434980    KZC13060.1    ATLV01018849    KE525251    KFB43381.1    GL444028    EFN61360.1    AXCM01000636    UFQS01001276    UFQT01001276    SSX10081.1    SSX29803.1    KQ414688    KOC63714.1    UFQS01000646    UFQT01000646    SSX05712.1    SSX26071.1    GL447755    EFN86050.1    KZ288199    PBC33642.1    NNAY01000654    OXU27164.1    KQ982691    KYQ52109.1    KQ767877    OAD53287.1    AAZO01003313    DS235271    EEB14162.1    LBMM01000571    KMQ98045.1    KB632384    ERL94272.1    APGK01047112    APGK01047113    APGK01047114    APGK01047115    APGK01047116    APGK01047117    APGK01047118    KB741077    ENN74141.1    GL888084    EGI67861.1    KQ977141    KYN05431.1    KK107235    EZA54880.1    QOIP01000009    RLU18201.1    ADTU01005848    ADTU01005849    KQ978644    KYN29472.1    KQ981572    KYN39778.1    GGMS01008884    MBY78087.1    KQ976738    KYM75717.1    GGMR01018852    MBY31471.1    GGMR01007858    MBY20477.1    ABLF02030722    ABLF02030734    ABLF02030735    ABLF02030737    ABLF02030738    GG666590    EEN51781.1   
Pfam
PF03028   Dynein_heavy        + More
PF18198   AAA_lid_11
PF12780   AAA_8
PF18199   Dynein_C
PF17852   Dynein_AAA_lid
PF08385   DHC_N1
PF17857   AAA_lid_1
PF12777   MT
PF12774   AAA_6
PF08393   DHC_N2
PF12781   AAA_9
PF07728   AAA_5
Interpro
IPR042228   Dynein_2_C        + More
IPR041228   Dynein_C       
IPR041658   AAA_lid_11       
IPR035699   AAA_6       
IPR013594   Dynein_heavy_dom-1       
IPR026983   DHC_fam       
IPR042219   AAA_lid_11_sf       
IPR013602   Dynein_heavy_dom-2       
IPR004273   Dynein_heavy_D6_P-loop       
IPR003593   AAA+_ATPase       
IPR041466   Dynein_AAA5_ext       
IPR027417   P-loop_NTPase       
IPR024743   Dynein_HC_stalk       
IPR024317   Dynein_heavy_chain_D4_dom       
IPR041589   DNAH3_AAA_lid_1       
IPR035706   AAA_9       
IPR042222   Dynein_2_N       
IPR011704   ATPase_dyneun-rel_AAA       
IPR009069   Cys_alpha_HP_mot_SF       
IPR036084   Ser_inhib-like_sf       
IPR030443   DNAH9       
SUPFAM
SSF52540   SSF52540        + More
SSF47072   SSF47072       
SSF57567   SSF57567       
Gene 3D
PDB
3VKH     E-value=2.24261e-20,     Score=240

Ontologies

Topology

Length:
203
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
2.3725
Exp number, first 60 AAs:
0
Total prob of N-in:
0.26351
outside
1  -  203
 
 

Population Genetic Test Statistics

Pi
27.273201
Theta
29.038374
Tajima's D
-1.101218
CLR
1.402396
CSRT
0.117094145292735
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号