Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO09956	P53	1.1e-26	1.6e-26	1	+ View
HMM length of domain: 196 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 93.1 0.4 9.5e-31 1.6e-26 4 194 71 266 Alignments for each domain: == domain 1 score: 93.1 bits; conditional E-value: 9.5e-31 ---S-B-TTTTEEEEESSBSSSTTTSEEEETTTTEEEEETTSEEEEEEEESS-S..STTEEEEEEEEESSCCCTTSB-B--HHHHHSST.TTTSSS CS P53 4 pstkdypgsyelklrfqksgtaksvtctysealnklfcqlaktcpvqvkvdkep..pkgsilratavykksehvaevvkrcphherssd.addgla 96 p +kd pg+y++ ++++ + t k + +s++ln+++ ++ vq + + + +rat v+ + v rc +h+ +s+ ++++ KWMTBOMO09956 71 PPRKDDPGQYNFSVEIHSKDTHKK-KFLFSHKLNRIYVNMETDFAVQFNWELVDlaVTQMYVRATVVFEDESQAEKRVERCIQHKLCSSdKGQDRV 165 667899********99999987.578***************987765411455689*******************98751555666 PP -TTBSEEEC...S-TT-EEEEETTTTEEEEEEE---SSTTSSSEEEEEEESS-TTCTTTTTTS-EEEEEEEEETTSCEEEEEEEEEEEESSHHHHH CS P53 97 pashlirve...gnqkaeyledkvtkrqsvvvpyeppqvgselttilynymcnssclggmnrrpiltiitletkegqllgrrsfevrvcacpgrdr 189 ++ ++r g++ ++y + v + p+ g e t ++++c sc g+nrr i +i tle+ +g +lgr++ +rvc+c rd KWMTBOMO09956 166 VSENVLRSSrplGTNDVQYCGHPDDPDYWYSVLVQLPKPGREPCTHAFKFVCKNSCSTGINRRSIAVIFTLESASGSVLGRQTVGARVCSCTARDM 261 6677776543449**9866665555555557899*******************************************************9 PP HHHHH CS P53 190 kteee 194 +ee KWMTBOMO09956 262 CKDEE 266 88887 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO09956

P53

1.1e-26

1.6e-26

+ View

						  HMM length of domain: 196 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	93.1	0.4	9.5e-31	1.6e-26	4	194	71	266

  Alignments for each domain:
  == domain 1  score: 93.1 bits;  conditional E-value: 9.5e-31
                    ---S-B-TTTTEEEEESSBSSSTTTSEEEETTTTEEEEETTSEEEEEEEESS-S..STTEEEEEEEEESSCCCTTSB-B--HHHHHSST.TTTSSS CS
            P53   4 pstkdypgsyelklrfqksgtaksvtctysealnklfcqlaktcpvqvkvdkep..pkgsilratavykksehvaevvkrcphherssd.addgla 96 
                    p +kd pg+y++ ++++ + t k   + +s++ln+++ ++     vq + +      +   +rat v+       + v rc +h+ +s+ ++++  
  KWMTBOMO09956  71 PPRKDDPGQYNFSVEIHSKDTHKK-KFLFSHKLNRIYVNMETDFAVQFNWELVDlaVTQMYVRATVVFEDESQAEKRVERCIQHKLCSSdKGQDRV 165
                    667899**********99999987.578*******************987765411455689***********************98751555666 PP

                    -TTBSEEEC...S-TT-EEEEETTTTEEEEEEE---SSTTSSSEEEEEEESS-TTCTTTTTTS-EEEEEEEEETTSCEEEEEEEEEEEESSHHHHH CS
            P53  97 pashlirve...gnqkaeyledkvtkrqsvvvpyeppqvgselttilynymcnssclggmnrrpiltiitletkegqllgrrsfevrvcacpgrdr 189
                     ++ ++r     g++ ++y   +        v  + p+ g e  t  ++++c  sc  g+nrr i +i tle+ +g +lgr++  +rvc+c  rd 
  KWMTBOMO09956 166 VSENVLRSSrplGTNDVQYCGHPDDPDYWYSVLVQLPKPGREPCTHAFKFVCKNSCSTGINRRSIAVIFTLESASGSVLGRQTVGARVCSCTARDM 261
                    6677776543449******9866665555555557899*********************************************************9 PP

                    HHHHH CS
            P53 190 kteee 194
                      +ee
  KWMTBOMO09956 262 CKDEE 266
                    88887 PP