Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO08398	Tub	2.1e-79	2.5e-79	1	+ View
HMM length of domain: 231 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 266.2 0.0 1.5e-83 2.5e-79 40 231 5 201 Alignments for each domain: == domain 1 score: 266.2 bits; conditional E-value: 1.5e-83 Tub 40 aarkrrrsttseYlisldaedlsrssesyvGklrsnflgtkftiydkgvkpkksaaekvrkelaavvYelnvlgtrgprrmkvlipsi.....kve 130 aarkr++s+ts+Ylis+d+++l+r+++s+ Gklrsn+lgt ft+yd+g+ +k++++k+r+ela+++Y++nvlg++gpr+m+v++p + +v+ KWMTBOMO08398 5 AARKRKKSATSNYLISTDPTELTRQADSFAGKLRSNLLGTAFTVYDNGKAWRKHDHAKTRYELASIIYDTNVLGFKGPRKMTVILPGMtpdrqRVA 100 79****************************************************************************************9899 PP Tub 131 vspkeeeeelqeeekkeeesdllvlknkaprwneqlqayvLnFrgRvtvaSvKNfqLvaaedeekvilqfGkvgkdvFtmDyryPlsalqAFaicl 226 + p++++e+l e+ k+++ +d++vl+nk+p wne++q+yvLnF+gRvt+aSvKNfq+v+++d e+v++qfG++++dvFtmD+ryPl+alqAF+i+l KWMTBOMO08398 101 IVPQDDSETLLERLKSQNYDDIVVLHNKTPVWNEETQSYVLNFHGRVTQASVKNFQIVHDSDPEYVVMQFGRISEDVFTMDFRYPLCALQAFGIAL 196 99****************************************************************************************** PP Tub 227 ssfdt 231 ssfd+ KWMTBOMO08398 197 SSFDS 201 *96 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO08398

Tub

2.1e-79

2.5e-79

+ View

						  HMM length of domain: 231 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	266.2	0.0	1.5e-83	2.5e-79	40	231	5	201

  Alignments for each domain:
  == domain 1  score: 266.2 bits;  conditional E-value: 1.5e-83
            Tub  40 aarkrrrsttseYlisldaedlsrssesyvGklrsnflgtkftiydkgvkpkksaaekvrkelaavvYelnvlgtrgprrmkvlipsi.....kve 130
                    aarkr++s+ts+Ylis+d+++l+r+++s+ Gklrsn+lgt ft+yd+g+  +k++++k+r+ela+++Y++nvlg++gpr+m+v++p +     +v+
  KWMTBOMO08398   5 AARKRKKSATSNYLISTDPTELTRQADSFAGKLRSNLLGTAFTVYDNGKAWRKHDHAKTRYELASIIYDTNVLGFKGPRKMTVILPGMtpdrqRVA 100
                    79******************************************************************************************9899 PP

            Tub 131 vspkeeeeelqeeekkeeesdllvlknkaprwneqlqayvLnFrgRvtvaSvKNfqLvaaedeekvilqfGkvgkdvFtmDyryPlsalqAFaicl 226
                    + p++++e+l e+ k+++ +d++vl+nk+p wne++q+yvLnF+gRvt+aSvKNfq+v+++d e+v++qfG++++dvFtmD+ryPl+alqAF+i+l
  KWMTBOMO08398 101 IVPQDDSETLLERLKSQNYDDIVVLHNKTPVWNEETQSYVLNFHGRVTQASVKNFQIVHDSDPEYVVMQFGRISEDVFTMDFRYPLCALQAFGIAL 196
                    99********************************************************************************************** PP

            Tub 227 ssfdt 231
                    ssfd+
  KWMTBOMO08398 197 SSFDS 201
                    ***96 PP