Silkworm Genome Informatics Database

Found: 1 items

Gene	Transcription Factor Family	Full Seq Evalue	Best Domain Evalue	Domain Number	Alignment Detail
KWMTBOMO01186	HMG	4.5e-14	8.2e-10	3	+ View
HMM length of domain: 69 aa c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs. i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. Domain annotation for each sequence: # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to -- ----- ---- -------- -------- ------- ------ ------- ------ --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 38.9 3.2 1.2e-12 8.2e-10 1 68 51 118 2 -1.7 1.4 5.2 3.7e+03 56 65 141 150 3 25.4 6.6 1.9e-08 1.3e-05 1 68 156 219 Alignments for each domain: == domain 1 score: 38.9 bits; conditional E-value: 1.2e-12 --SS--HHHHHHHHHHHHHHHHSTTS-HHHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHHCCH CS HMG 1 pkRplsafflfskeqraklkaenPelknaeiskklgekWkalseeeKkkYeekaekekaryekekpey 68 pkRpl+ ff f++++r+ l a+nP+++ +e ++ W++l e K + ++++k+ + y+k k+ y KWMTBOMO01186 51 PKRPLTPFFKFMSQMRPALLAKNPGISSKEAIAWTSKHWQQLDMETKTQMAKEYQKDLEDYNKIKAMY 118 8***********************************************************999888 PP == domain 2 score: -1.7 bits; conditional E-value: 5.2 HHHHHHHHHH CS HMG 56 kekaryekek 65 kek + ++e+ KWMTBOMO01186 141 KEKRKLKAEY 150 3333333333 PP == domain 3 score: 25.4 bits; conditional E-value: 1.9e-08 --SS--HHHHHHHHHHHHHHHHSTTS-HHHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHHCCH CS HMG 1 pkRplsafflfskeqraklkaenPelknaeiskklgekWkalseeeKkkYeekaekekaryekekpey 68 pk+p+s++f++++ ++++ + + +e ++ + W +l+++eK+k e++a+ + +y+k+ +++ KWMTBOMO01186 156 PKKPMSSYFIYMQSRKDNIQGK----TLKEYQETVKKDWINLPDSEKAKLEKQAQTLMDKYKKDLQAW 219 8***********999865....6888899999**************************9998 PP

Gene

Transcription Factor Family

Full Seq Evalue

Best Domain Evalue

Domain Number

Alignment Detail

KWMTBOMO01186

HMG

4.5e-14

8.2e-10

+ View

						  HMM length of domain: 69 aa

c-Evalue (conditional Evalue): It is an attempt to measure the statistical significance of each domain, given that we’ve already decided that the target sequence is a true homolog. It is the expected number of additional domains we’d find with a domain score this big in the set of sequences reported in the top hits list, if those sequences consisted only of random nonhomologous sequence outside the region that sufficed to define them as homologs.
i-Evalue (independent Evalue): The significance of the sequence in the whole database search, if this were the only domain we had identified. 
Domain annotation for each sequence:
#	score	bias	c-Evalue	i-Evalue	hmmfrom	hmm to	alifrom	ali to
--	-----	----	--------	--------	-------	------	-------	------
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
1	38.9	3.2	1.2e-12	8.2e-10	1	68	51	118
2	-1.7	1.4	5.2	3.7e+03	56	65	141	150
3	25.4	6.6	1.9e-08	1.3e-05	1	68	156	219

  Alignments for each domain:
  == domain 1  score: 38.9 bits;  conditional E-value: 1.2e-12
                    --SS--HHHHHHHHHHHHHHHHSTTS-HHHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHHCCH CS
            HMG   1 pkRplsafflfskeqraklkaenPelknaeiskklgekWkalseeeKkkYeekaekekaryekekpey 68 
                    pkRpl+ ff f++++r+ l a+nP+++ +e     ++ W++l  e K +  ++++k+ + y+k k+ y
  KWMTBOMO01186  51 PKRPLTPFFKFMSQMRPALLAKNPGISSKEAIAWTSKHWQQLDMETKTQMAKEYQKDLEDYNKIKAMY 118
                    8*************************************************************999888 PP

  == domain 2  score: -1.7 bits;  conditional E-value: 5.2
                    HHHHHHHHHH CS
            HMG  56 kekaryekek 65 
                    kek + ++e+
  KWMTBOMO01186 141 KEKRKLKAEY 150
                    3333333333 PP

  == domain 3  score: 25.4 bits;  conditional E-value: 1.9e-08
                    --SS--HHHHHHHHHHHHHHHHSTTS-HHHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHHCCH CS
            HMG   1 pkRplsafflfskeqraklkaenPelknaeiskklgekWkalseeeKkkYeekaekekaryekekpey 68 
                    pk+p+s++f++++  ++++  +    + +e   ++ + W +l+++eK+k e++a+ +  +y+k+ +++
  KWMTBOMO01186 156 PKKPMSSYFIYMQSRKDNIQGK----TLKEYQETVKKDWINLPDSEKAKLEKQAQTLMDKYKKDLQAW 219
                    8***************999865....6888899999****************************9998 PP