SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16848
Annotation
PREDICTED:_antigen_43-like_isoform_X3_[Salmo_salar]
Location in the cell
Extracellular   Reliability : 1.832 Nuclear   Reliability : 1.657
 

Sequence

CDS
ATGCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCATGCTGCAACGTCGCTCTGCAACATCATTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCATCGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCGCTATGCAACGTCATGCTGCAACGTCATTCTGCAAAGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTTCAACGTCCCTCAGCAACGTCATGCTGCAAAGTCGCTCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCATGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGATGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTTCAACGTCATGCTGCAACGTCATTCTGCAACGTCACGCTGCAACGTCGCTATGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATTCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTTCAACGTCCCTCAGCAACGTCATGCTGCAAAGTGTCTAA
Protein
MLQRHSATSLCNVMLQRRYATSFCNVALQRHAATSLCNVILQRRSATSLCNVMLQSRSATSFCNVALQRHSATSLCNVAMQRHAAKSLCNVMLQRHSATSLCNVILQRRYATSFCNVALQRRYATSFCNVQRHSATSLCNVAMQRHAAKSLCNVAMQRHAAKSLCNVILQRRSATSCCNVALQRHSATSLCNVAMQRHAAKSLCNVILQRRSATSFCNVALQRRYATSCCKVALQRHSATSCCNVMLQRRSATSFCNVILQRRSATSFCNVALQRHAAKSLCNVILQRRSATSLCNVMLQRRYATSFCNVALQRHSATSFCNVALQRHAATSFCNVILQRHAATSLCNVILQRRSATSCCNVALQRHAATSLCNVMLQRRSATSCCNVALQRHAATSLCNVAMQRHAAKSLCNVILQRHAATSLCNVILQRHAATSLCNVMLQRRSATSCCNVALQRHAASSLCNVMLQRRSATSFCNVALQRRYATSCCKVALQRHSATSCCNVAMQRRSATSLCNVMLQSRSATSLCNVMLQRHSAKSLCNVILQRRSATSCCNVILQRRSATSCCNVALQRHASTSLSNVMLQSRSATSFCNVALQRHAATSLCNVALQRHAATSFCNVMLQRRYATSFCNVALQRHDATSLCNVMLQRRSSTSCCNVILQRHAATSLCNVILQRRSATSCCNVILQRRSATSCCNVALQRHASTSLSNVMLQSV

Summary

Catalytic Activity
H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
Pfam
PF13306   LRR_5        + More
PF00102   Y_phosphatase
PF03448   MgtE_N
Interpro
IPR011004   Trimer_LpxA-like_sf        + More
IPR026906   LRR_5       
IPR033201   HRNR       
IPR000242   PTPase_domain       
IPR000387   TYR_PHOSPHATASE_dom       
IPR016130   Tyr_Pase_AS       
IPR003595   Tyr_Pase_cat       
IPR029021   Prot-tyrosine_phosphatase-like       
IPR020683   Ankyrin_rpt-contain_dom       
IPR001762   Disintegrin_dom       
IPR036436   Disintegrin_dom_sf       
IPR006668   Mg_transptr_MgtE_intracell_dom       
IPR038076   MgtE_N_sf       
IPR037727   KIAA0754       
SUPFAM
SSF51161   SSF51161        + More
SSF52799   SSF52799       
SSF57552   SSF57552       
Gene 3D

Ontologies

Topology

Length:
718
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00666999999999998
Exp number, first 60 AAs:
0.00594
Total prob of N-in:
0.00044
outside
1  -  718
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号