SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16840
Pre Gene Modal
BGIBMGA008832
Annotation
Retrovirus-related_Pol_polyprotein_from_transposon_TNT_1-94_[Papilio_machaon]
Location in the cell
Cytoplasmic   Reliability : 1.788 Nuclear   Reliability : 1.172
 

Sequence

CDS
ATGAGCTACCCACTATTCTCCGCTGAGGCAAGCTTCGTGAGATTAGTCGACAACCCTGATGATCCCCAGACTGCAGCCGAGGCCTTAAACGGGCCTGAATCGGACAGTTGGAGAAAGGCAATGACAGATGAGTATAATTCCTTTGTTAAGAACAAGTGTTGGACCCTGACTGAGCATGAACCCAGCCGCAAACCAGTCAAATGTAAATGGATTTTTAAAAGAAAATATGGAGCAGATGGAGAGTTACTAAAGTATAAAGCTCGTTTAGTTGCCAAGGGTTACACACAGAAGTACGGTGTTGATTATCAAGAGACTTTTTCACCAGTGGTAAGGTACTCCACAATTAGGATTTTACTTGCTTTAGCAGCTGAACATGGCCTGTCCATTGAGCACCTGGATGTCAAAACGGCGTTCCTTAATGGCGACCTCGAGGAAACTGTATACATGGAGCAGCCAGAGTTCTTTGAAGAAAAAGGAAAAGAGAACATGGTGTACAGGCTAAATAAAGCTGTGTACGGCTTAAAACAGGCATCCAAGACATGCTCTCTATGTCGATGA
Protein
MSYPLFSAEASFVRLVDNPDDPQTAAEALNGPESDSWRKAMTDEYNSFVKNKCWTLTEHEPSRKPVKCKWIFKRKYGADGELLKYKARLVAKGYTQKYGVDYQETFSPVVRYSTIRILLALAAEHGLSIEHLDVKTAFLNGDLEETVYMEQPEFFEEKGKENMVYRLNKAVYGLKQASKTCSLCR

Summary

EMBL
NWSH01004969    PCG64541.1    KQ460882    KPJ11482.1    OIVN01006335    SPD30828.1    + More
CM003612    KYP59836.1    AC025296    AAK39592.1    PKPP01000362    PWA93738.1    JXUM01130663    KQ567605    KXJ69347.1    KQ992547    KZV50107.1    DP000086    ABG66099.1    LSMT01001145    PFX12880.1    OIVN01002503    SPD04186.1    AC091122    AAM94928.1    OIVN01002268    SPD02135.1    KV000919    KZV39555.1    CM007893    OTG29580.1    CM007894    OTG24314.1    CM007892    OTG32030.1    OTG26849.1    OIVN01000350    SPC78805.1    ABG66192.1    KQ991591    KZV51625.1    CM003608    KYP66596.1    KYP65681.1    ASHM01023333    PNX71449.1    OIVN01006381    SPD31869.1    CM007903    OTF98090.1    OIVN01006204    SPD27708.1    OIVN01000113    SPC74546.1    OIVN01001208    SPC91157.1    OIVN01000395    SPC79545.1    OIVN01003897    SPD14257.1    DP000009    ABF93649.1    OIVN01004921    SPD19975.1    OIVN01004614    SPD18379.1    QZWG01000009    RZB91995.1    OIVN01005068    SPD20708.1    OIVN01002564    SPD04723.1    OIVN01000260    SPC77255.1    OIVN01006372    SPD31671.1    OIVN01003534    SPD11893.1    OIVN01005646    SPD23424.1    DP000011    ABA96091.1    OIVN01000116    SPC74628.1    QGNW01000392    RVW73434.1    OIVN01000191    SPC75975.1    OIVN01002224    SPD01757.1    OIVN01006429    SPD32977.1    OIVN01001196    SPC91020.1    QGNW01002719    RVW12147.1    OIVN01006238    SPD28613.1    OIVN01002940    SPD07631.1    OIVN01001733    SPC97079.1    OIVN01000189    SPC75922.1    OIVN01002247    SPD01987.1    OIVN01000958    SPC87933.1    OIVN01002491    SPD04083.1    OIVN01000183    SPC75833.1    OIVN01003558    SPD12118.1    OIVN01001091    SPC89740.1    OIVN01001484    SPC94512.1    OIVN01005024    SPD20514.1    OIVN01001669    SPC96464.1    OIVN01004423    SPD17240.1    OIVN01004420    SPD17230.1    OIVN01005186    SPD21283.1    OIVN01002444    SPD03657.1    OIVN01000147    SPC75222.1    CM007891    OTG34881.1    ABA98785.1    OIVN01001052    SPC89229.1    OIVN01001890    SPC98658.1    OIVN01001130    SPC90232.1    OIVN01000404    SPC79669.1    OIVN01000557    SPC82046.1    OIVN01005657    SPD23465.1    OIVN01001520    SPC94877.1    OIVN01001666    SPC96375.1    AC128644    DP000010    AAX96353.1    ABA91827.1    AC090482    AAM00978.1    AAP53107.1    OIVN01000095    SPC74169.1    ASHM01054917    PNX87842.1    ABA97124.1    CM000144    EEE67150.1    ABF99156.1    KV013340    KZV23924.1    OIVN01004603    SPD18338.1    OIVN01001202    SPC91100.1    AC084748    AAM19019.1    OIVN01005334    SPD21977.1    AC090870    AAM95676.1    OIVN01005059    SPD20680.1    OIVN01006233    SPD28466.1    OIVN01000151    SPC75285.1    AC133932    AAP50927.1    ABF96500.1    AC136522    AAV43959.2    OIVN01001309    SPC92453.1    ABB47865.2    ABA96959.2    OIVN01002854    SPD06945.1   
Pfam
PF07727   RVT_2        + More
PF13976   gag_pre-integrs
PF00665   rve
PF13961   DUF4219
PF00098   zf-CCHC
Interpro
IPR013103   RVT_2        + More
IPR039537   Retrotran_Ty1/copia-like       
IPR036875   Znf_CCHC_sf       
IPR012337   RNaseH-like_sf       
IPR001878   Znf_CCHC       
IPR001584   Integrase_cat-core       
IPR025314   DUF4219       
IPR025724   GAG-pre-integrase_dom       
IPR036397   RNaseH_sf       
IPR001995   Peptidase_A2_cat       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
Gene 3D

Ontologies

Topology

Length:
185
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00346
Exp number, first 60 AAs:
0
Total prob of N-in:
0.02753
outside
1  -  185
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号