SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16837
Annotation
PREDICTED:_dentin_sialophosphoprotein-like_[Biomphalaria_glabrata]
Location in the cell
Nuclear   Reliability : 2.198
 

Sequence

CDS
ATGTTGACAATTACCGTCTATGTAATAATACAGTGTAATGTAATCGTTTCTTTTGTTACAGCATCTGCCGCATCCACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAATCCTACTTCAGATCCAAGTGCGTCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAATGCATCTGCCGCATCCACGACCGATACATCTGTAACGGATAAACCCACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGGTACATCTGTAACGGATAAACCTACTTCAGATCAAAGTGCATCTGCCCGCATCGACGACGATACATCTGTAACGGATAATCCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAATCCTACTTCAGATCCAAGTGCGTCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCAAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAATCCTACTTCAGATCCAAGTGCGTCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACCCATACATCTGTAACGGATAAACCTACTTCAGATCAAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATATATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCGTCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCACATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATATATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCGTCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATATATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCGTCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCGACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCCAAGTGTAAGTTTCCATAAAAAGGTTGACAATTACCGTCTATCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACCGATACATCTGTAACGGATAAACCTACTTCAGATCAAAGTGCATCTACCGCATCGACGACCGATACATCTGTAACGGACAAACCTACTTCAGATCCAAGTGCATCTGCCGCATCCACGACAGACAAATCTGTAACGGATAAACCTACTTCAGATCCAAGTGGTAAGTTTCCATAA
Protein
MLTITVYVIIQCNVIVSFVTASAASTTDTSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDTSVTDNPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPNASAASTTDTSVTDKPTSDPSASAASTTGTSVTDKPTSDQSASARIDDDTSVTDNPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDNPTSDPSASAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTDTSVTDKPTSDQSASAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDNPTSDPSASAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTHTSVTDKPTSDQSASTASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDISVTDKPTSDPSASAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASATSTTDKSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDISVTDKPTSDPSASAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDISVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSASAASTTDTSVTDKPTSDPSVSFHKKVDNYRLSSAASTTDKSVTDKPTSDPSASTASTTDTSVTDKPTSDPSASAASTTDTSVTDKPTSDQSASTASTTDTSVTDKPTSDPSASAASTTDKSVTDKPTSDPSGKFP

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

SignalP
Position:   1 - 23,         Likelihood:  0.516210
 
 
Length:
1236
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.22767
Exp number, first 60 AAs:
3.22767
Total prob of N-in:
0.15199
outside
1  -  1236
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号