SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16830
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.732 Nuclear   Reliability : 1.571
 

Sequence

CDS
ATGCGATCGGCCATGGATAAACTCAGAAAAGTATGGAAGGACCGGAATATCACCAAGACTACCAAAGTCCGACTGGTAAGGGCACTGGTGTTCCCCATCTTTTTATATGGGGTTGAGACCTCGACTGTGAAAGAAAGAGAAAAAAGAAGGATCGATGCATTAGAAATGTGTTGCTGGAGAAGGATGCTCCAACACATAATCAGTCATAAAAATGCTTTGCCGTTCTGTGCTAAGTCTTGA
Protein
MRSAMDKLRKVWKDRNITKTTKVRLVRALVFPIFLYGVETSTVKEREKRRIDALEMCCWRRMLQHIISHKNALPFCAKS

Summary

Similarity
Belongs to the glycosyltransferase 47 family.
EMBL
FJ265552    ADI61820.1    FJ265560    ADI61828.1    RSAL01000235    RVE43733.1    + More
RSAL01000427    RVE41762.1    FJ265547    ADI61815.1    FJ265557    ADI61825.1    FJ265553    ADI61821.1    FJ265546    ADI61814.1    ODYU01001007    SOQ36619.1    LBMM01011957    KMQ86521.1    KZ150203    PZC72267.1    RSAL01000289    RVE42931.1    FJ265548    ADI61816.1    ODYU01003523    SOQ42419.1    LK054988    CDR71535.1    BDSA01000081    GBE63537.1    MKPU01000878    OIR55924.1    BDOT01000373    GCF57844.1    BDOT01000977    GCF61383.1    NCKU01012182    RWS00163.1    NCKU01008836    RWS01655.1    BDOT01000029    GCF46290.1    BDOT01000018    GCF44776.1    BDOT01000002    GCF40157.1    NCKU01006316    RWS03634.1    BDOT01000067    GCF49533.1    BDOT01000015    GCF44366.1    GCF40355.1    BDOT01000141    GCF52733.1    BDOT01000123    GCF52043.1    BDOT01000020    GCF44950.1    BDOT01000039    GCF47390.1    GCF47350.1    BDOT01000011    GCF43483.1    NCKU01003098    RWS08177.1    BDOT01000005    GCF41529.1    BDOT01000001    GCF39495.1    GCF44165.1    BDOT01000056    GCF48718.1    BDOT01000385    GCF57999.1    BDOT01000082    GCF50401.1    AMGL01085089    AMGL01085090    AMGL01085091    BDOT01000008    GCF42803.1    BDOT01000051    GCF48398.1    BDOT01000282    GCF56465.1    BDOT01000055    GCF48663.1    GCF52736.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03392   OS-D
PF02146   SIR2
PF09258   Glyco_transf_64
PF03016   Exostosin
PF03372   Exo_endo_phos
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR005055   A10/PebIII       
IPR036682   OS_D_A10/PebIII_sf       
IPR029035   DHS-like_NAD/FAD-binding_dom       
IPR003000   Sirtuin       
IPR026590   Ssirtuin_cat_dom       
IPR002138   Pept_C14_p10       
IPR029044   Nucleotide-diphossugar_trans       
IPR040911   Exostosin_GT47       
IPR015338   GT64       
IPR004263   Exostosin       
IPR027673   Exostosin-2       
SUPFAM
SSF56219   SSF56219        + More
SSF100910   SSF100910       
SSF52467   SSF52467       
SSF53448   SSF53448       
Gene 3D

Ontologies

Topology

Length:
79
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
9.47598999999999
Exp number, first 60 AAs:
9.47584
Total prob of N-in:
0.82916
inside
1  -  79
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号