SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16814  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA010203
Annotation
serine_protease_[Bombyx_mandarina]
Location in the cell
Extracellular   Reliability : 2.575
 

Sequence

CDS
ATGGAAAAAAATCCGATTTTTCCAGCTGCTTCGGGAGCCAACAACCAACAAAAACGCCAAGTGAGCCTCCAGGTCATTACCAACGCCGTCTGCGCCCGCACGTACGGAAACTCTGTGATCATTGGCTCCACCCTCTGTGTTTCCGGCTCTAACGGTCGCAGCACCTGCAGCGGAGACTCCGGCGGCCCTCTCTCCATCGGCAGCGGCGGAGCCGTCAGCTGGTCAGTACACTAG
Protein
MEKNPIFPAASGANNQQKRQVSLQVITNAVCARTYGNSVIIGSTLCVSGSNGRSTCSGDSGGPLSIGSGGAVSWSVH

Summary

Similarity
Belongs to the peptidase S1 family.
EMBL
BABH01011411    BABH01011412    BABH01011413    BABH01041853    AY945210    EU338400    + More
AAX39408.1    ABY58153.1    BABH01042790    AB003670    BAA20136.1    BABH01041852    BABH01041861    AB117641    BAD13342.1    BABH01041859    BABH01041860    AY945211    DQ310733    AAX39409.1    ABC26003.1    KF039687    AGU27161.1    JTDY01002254    KOB71786.1    KR024679    ALE15221.1    RSAL01000073    RVE48983.1    MH201552    QAR48645.1    EU672968    ACD44927.1    KQ459472    KPJ00237.1    BABH01041868    RVE48982.1    AY953058    AAX62031.1    KZ150191    PZC72392.1    AY953056    AY953057    AAX62029.1    AAX62030.1    KQ461033    KPJ09997.1    EU000266    ABW37103.1    KM083780    AIR09761.1    KQ459581    KPI99177.1    AF237417    EF531621    AAF43709.1    ABR88232.1    JN252036    AFM28249.1    GDHF01001628    JAI50686.1    GDHF01028344    JAI23970.1    NWSH01001552    PCG70875.1    CVRI01000020    CRK90893.1    KR024673    ALE15215.1    CM000159    EDW93580.1    QHKM01000034    RAK61917.1    GBYB01007311    JAG77078.1    GAKP01011239    JAC47713.1    KU234350    ALR85841.1    KU234349    ALR85840.1    AE014296    AY061559    AAF50714.1    AAL29107.1    AY071658    AAL49280.1    EU000268    ABW37105.1    KU234347    KU234348    ALR85838.1    ALR85839.1    HM990178    ADT80826.1    JRES01001494    KNC22486.1    KU234354    ALR85845.1    KU234353    ALR85844.1    CH479214    EDW33370.1    HM990183    ADT80831.1    KNC22485.1    PCG70877.1    CM000363    CM002912    EDX09387.1    KMY97841.1    EDW33369.1    CH379069    KRT08151.1    EAL29587.2    PCG70876.1    CH902618    EDV40760.1    KR024680    ALE15222.1    AM412897    AM412898    AM412899    AM412900    CAL85520.1    CAL85521.1    CAL85522.1    CAL85523.1    AF302469    AAG30230.1    RSAL01000169    RVE45196.1    KNC22488.1    GFDL01005094    JAV29951.1    FJ205420    ACR15987.3   
Pfam
PF00089   Trypsin        + More
PF00611   FCH
Interpro
IPR033116   TRYPSIN_SER        + More
IPR001254   Trypsin_dom       
IPR009003   Peptidase_S1_PA       
IPR018114   TRYPSIN_HIS       
IPR001314   Peptidase_S1A       
IPR027267   AH/BAR_dom_sf       
IPR001060   FCH_dom       
SUPFAM
SSF50494   SSF50494        + More
SSF103657   SSF103657       
PDB
1YM0     E-value=6.58821e-05,     Score=103

Ontologies

Topology

Length:
77
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.14317
Exp number, first 60 AAs:
0.14176
Total prob of N-in:
0.15519
outside
1  -  77
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QLIGITSFGSAQGCQR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QLIGITSFGSDR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QVSLQVITNAVCAR 100.00 0.002
28556443 QLIGITSFGSAQGCQR 100.00 0.002
28556443 QLIGITSFGSAQGCQR 100.00 0.002
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号