SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16811
Annotation
NA
Location in the cell
Nuclear   Reliability : 2.853
 

Sequence

CDS
ATGTTCGGCATCAGGACACCCGTTAAAAAATCAAACGGCAGTGAGGAGAAATCTGAACTCAAGGAACTGCCATGTCTGTCTGTGAGGCGCAGCATTGGTGATTGGCCCCCTACAGCCGAAAAAGAGCAGCAAGAGCAGCAAAGGCCAAAAATACCATCTCCACCAAAAGCTGTGCCTCAGCCGCTCCCTCCTAGGCCTAAGACCAAAGCTTCGATCGCCCAGGAAGCGAAAGCCGACCTAGGCAGACAGGCAACCAGAGTCAGCGACAGCCGCCGAACATAG
Protein
MFGIRTPVKKSNGSEEKSELKELPCLSVRRSIGDWPPTAEKEQQEQQRPKIPSPPKAVPQPLPPRPKTKASIAQEAKADLGRQATRVSDSRRT

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
93
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.41374
outside
1  -  93
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号