SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16806
Annotation
hypothetical_protein_TcasGA2_TC031727_[Tribolium_castaneum]
Location in the cell
Nuclear   Reliability : 2.134
 

Sequence

CDS
ATGGTTTTTACGATAAAATTTTTATCCCTACAAAAAACTGAACTGGAATACGAAGTTGCGATAAGAGGTGAGACCCCCGGTGCTACGGTGGCTGATCTTAGGAAACAGATTAGCAAATTAAGTCAATCTTTTCCTTCAGAAGATGTATTATGTTCTCATCTCGAACCCCTAGATGATCTTCAAGCTGTTTTGGACTTGCTGAATAAAGTCAATGCAAGTCTCGAGTCAAGCCCTACTGATAAAAGTACATTATCGCGCATAGAAAATATTTTTCATCACCTTTATCATAGGATCAACAGAATAGTGGTTGATGAAGTAGAGAAGCTGCACTCTGCTTGTAGTAAACTTTTTAAAGAATTCTACGAAAAATTCCAGAAATTAAGCAAAAAGGCAATTGATCCTCTATTAGTTGGTGTATCTAGTTCAGCATCTGCTTCTGTACCTGGCATTCAGGCACCAATTAATGTCGCTGTTACTTGTGATAGAGGTGTTACTTCAGAACTGAGTAGGCTGAAGTTCGATGGTAAGTCATGTGTTCGATCTTTTATTCAACGTGTTTACGAATTTAGCGAGGCGCGTAGCATCCCCGACTCAAAACTTCTCTCATCTGCTACAGAAATATTTACAGATGATGCGCTGCATTGGTTCAGGAGTATTAAGGACCAGGTTTCATCTTGGGATGATCTTGTTGTTCTTTTAAAAAAAGATTTTGATAAAGCAGACTATGATTACCGTTTACTTGCTGAGATTCGTGCTAGGACTCAAGGGGAAACGGAAAATATTACGATATACTTAGCTATTCTCTCGGGGATTGACTTTTGGCACACATTTAAAATTTGCCCGAAGTACTTGAGTTCTCTTCATTTCCCCGGCCCTCCATTGGCTAATTTAGATGTTGGTAGCCCAACCAATTTTTTGCGCTCGTATGATTATTTGGACGAATCACAAAAGGCCGTCGTTGACAATATTACCAAGCAGTTTGAAGAAATATCTTTTGAGCGCAAAGGACTTGGACGCACAAACTTAATTACTCACCACATCGACACGGGGAATTCTCCTCCTGTGAGACAGCGCTACTATAGGCTTTCACCAGAGAAACAGAGAATCCTAGTCGAGCAAGTAGACGAAATGCTCCAGCTTGATGTAGTTGAGCCTTGTGAGAGTGCCTGGCAATCCCCGGTATTGCTAGTCACTAAAAAAGATGGTCAGCCGCGGTTCTGCTTAGATAGTAGGAAGCTAAACTCTGTTACAAAACGCGACGCTTATAACTTACCTTACATATCGGAGATATTGGACAACTTGCGAGACGCGCGCTATCTTAGCAGTATTGACTTATCAAAGGCTTTCTGGCAATTACCAATAGCACTCGAAGATAGGGACAAGACGGCATTTTACGTTCCGGGACGAGGGACGTTACGGTTCAAGACTACACCGTTTGGTTTGACCAATGCGCCTTCTACGCAACAGCGGTTAGTCGATTTATTGTTTGGCGACATGGATCACAAGGCGTTCGCATATTTAGATGATGTGATAATAGTAAGTAGCACGTTTGATGAGCATGTTAGTCTTCTTCTTCGCGTGTTAGACAAGCTGCGCCATGCTAATCTAACAATTAATTTAGAAAAGTGTGAATTTTTTCGAAGTAAGCTTAAATATTTAGGCTATGTGGTCGACGCGAATGGTTTGCGGACTGATCCGGATAAAGTTACAGCCATTCTAAATTACCCAACTCCTACATGTCGTAAGGACTTGAAACGGTTCCTAGGCACGGCAACATGGTACCGGAGATTTGTCCCAAACTTTAGCACTATCGCAGGGCCGCTTAATAGGTTGACATCGAACAAAAAATCAACACCTCCCTTCCAGTGGACAGATGAGGCCGACACTGCGTTCAAAAAACTTAAGGAATCTTTGGTCTCTGCACCTGTTCTCTCCTGCCCAAATTACGATCTGCCTTTCGAAGTCCATACAGATGCTAGTAACTATGGGATAGGTGGTATGCTCACACAAACTATTGACGGGAAAGAGCACCCTATAGCGTATATGAGCAAGTCCTTATCGGGGGCCGAAAAGAATTATAGCATTACCGAACGTGAGACCTTAGCTGTTCTCGTGGCTCTCGAGCACTGGCGTTGCTATCTGGAGAACGGAAAGACATTTACGGTTTACACAGACCACAGCGCACTTAAGTGGTTCCTTTCCTTGAACAATCCTACGGGTAGGCTTGCACGTTGGGGAGTTCGATTATCGTCGTTTGATTTTGAAATCAAACACCGCCGCGGTGTAGACAATGTGATTCCCGACGCTTTGTCTAGAGCTGTCCGCGTCACTACTATCACTACTGCTAAATCACTCACGACTTCTAGTGATGATTGAAAGCCTTTTGAATTTAATGTAGGAGATACTGTTTATAAACGCGCTTACGTCCTGAGTGACAAAGATAAGTATTTTAGTAAGAAGTTAGCACCGAAATATATCAAGTGCAAAGTTGTCGAAAAACTCTCGCCACTTGTCTACGTTCTAGAAGACATGTCGGTAAAAAACATAGGCACTTGGCATATTAAAGACTTGAAAATATTAGGTCAACACTCATAG
Protein
MVFTIKFLSLQKTELEYEVAIRGETPGATVADLRKQISKLSQSFPSEDVLCSHLEPLDDLQAVLDLLNKVNASLESSPTDKSTLSRIENIFHHLYHRINRIVVDEVEKLHSACSKLFKEFYEKFQKLSKKAIDPLLVGVSSSASASVPGIQAPINVAVTCDRGVTSELSRLKFDGKSCVRSFIQRVYEFSEARSIPDSKLLSSATEIFTDDALHWFRSIKDQVSSWDDLVVLLKKDFDKADYDYRLLAEIRARTQGETENITIYLAILSGIDFWHTFKICPKYLSSLHFPGPPLANLDVGSPTNFLRSYDYLDESQKAVVDNITKQFEEISFERKGLGRTNLITHHIDTGNSPPVRQRYYRLSPEKQRILVEQVDEMLQLDVVEPCESAWQSPVLLVTKKDGQPRFCLDSRKLNSVTKRDAYNLPYISEILDNLRDARYLSSIDLSKAFWQLPIALEDRDKTAFYVPGRGTLRFKTTPFGLTNAPSTQQRLVDLLFGDMDHKAFAYLDDVIIVSSTFDEHVSLLLRVLDKLRHANLTINLEKCEFFRSKLKYLGYVVDANGLRTDPDKVTAILNYPTPTCRKDLKRFLGTATWYRRFVPNFSTIAGPLNRLTSNKKSTPPFQWTDEADTAFKKLKESLVSAPVLSCPNYDLPFEVHTDASNYGIGGMLTQTIDGKEHPIAYMSKSLSGAEKNYSITERETLAVLVALEHWRCYLENGKTFTVYTDHSALKWFLSLNNPTGRLARWGVRLSSFDFEIKHRRGVDNVIPDALSRAVRVTTITTAKSLTTSSDDXKPFEFNVGDTVYKRAYVLSDKDKYFSKKLAPKYIKCKVVEKLSPLVYVLEDMSVKNIGTWHIKDLKILGQHS

Summary

Uniprot
Pfam
PF00078   RVT_1        + More
PF00665   rve
PF17921   Integrase_H2C2
PF17919   RT_RNaseH_2
Interpro
IPR012337   RNaseH-like_sf        + More
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR000477   RT_dom       
SUPFAM
SSF53098   SSF53098       
Gene 3D
ProteinModelPortal
PDB
4OL8     E-value=1.2859e-71,     Score=689

Ontologies

Topology

Length:
864
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00830999999999999
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00042
outside
1  -  864
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号