SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16799
Annotation
phosphatidylinositol-4-phosphate_5-kinase_type-1_alpha_[Lasius_niger]
Location in the cell
Cytoplasmic   Reliability : 1.844 Nuclear   Reliability : 1.645
 

Sequence

CDS
ATGGAGAGCATACAGGCGGAAAGCGAGCCCATAGATGAGGAGGAAGATGTCCCGTCCGGCGGCATCCCGGCCCGGAACGCGCGTGGCGAGCGTCTGCTGCTGTTCCTGGGCATCATCGACATACTCCAGTCGTATCGTCTCCGGAAGAAGCTCGAGCACACTTGGAAGAGCATGATACACGATGGCGACACTGTATCGGTCCACAGACCCAGCTTCTACGCTCAGAGATTCTTAGATTTCATGGCTAAAACCGTTTTCAAGAAGATACCTTCGTATCCAGAGACATGA
Protein
MESIQAESEPIDEEEDVPSGGIPARNARGERLLLFLGIIDILQSYRLRKKLEHTWKSMIHDGDTVSVHRPSFYAQRFLDFMAKTVFKKIPSYPET

Summary

EMBL
KY609557    ASO76421.1    LBMM01003447    KMQ93529.1    NWSH01001293    PCG71816.1    + More
RSAL01000127    RVE46519.1    ODYU01001460    SOQ37685.1    ATLV01014632    KE524975    KFB39309.1    KQ982562    KYQ54831.1    GL436229    EFN72215.1    PYGN01000163    PSN52385.1    KQ978642    KYN29517.1    KQ981993    KYN31003.1    GL448322    EFN84793.1    KQ976543    KYM81004.1    KQ976881    KYN07602.1    ADTU01024787    ADTU01024788    GL887655    EGI70484.1    KK107874    EZA47349.1    KZ288247    PBC31176.1    KQ791045    OAD47036.1    GBYB01010570    JAG80337.1    GBYB01010572    JAG80339.1    GECU01032498    JAS75208.1    KQ414617    KOC68367.1    KQ434899    KZC10869.1    NEVH01017587    PNF23746.1    PNF23750.1    PNF23751.1    PNF23748.1    PNF23753.1    PNF23752.1    LJIG01009489    KRT82978.1    QOIP01000010    RLU17516.1    KK853162    KDR10437.1    CH478832    EAT32594.1    AXCM01001968    GAPW01001171    JAC12427.1    GECU01033960    JAS73746.1    GGFM01003531    MBW24282.1    GFDL01016150    JAV18895.1    GEZM01019595    JAV89601.1    GGFK01007395    MBW40716.1    GECU01017421    JAS90285.1    GEDV01009919    JAP78638.1    GECU01007856    JAS99850.1    GEHC01000741    JAV46904.1    GECU01023736    JAS83970.1    GGFK01007450    MBW40771.1    GFDL01009417    JAV25628.1    CH477649    EAT37821.1    GANO01003279    JAB56592.1    DS231957    EDS29006.1    GGFJ01002584    MBW51725.1    GGFL01001481    MBW65659.1    GGFM01002200    MBW22951.1    GALA01000138    JAA94714.1    GALA01001239    JAA93613.1    GGFL01000975    MBW65153.1    GGFK01005846    MBW39167.1    GGFL01001170    MBW65348.1    KQ971351    KYB26781.1    GGFK01005963    MBW39284.1    KYB26780.1    ADMH02001355    ETN62891.1    KYB26783.1    GEDC01003899    JAS33399.1    GEDC01023417    JAS13881.1    GEDC01019396    JAS17902.1    GEDC01027902    JAS09396.1    GEBQ01015681    JAT24296.1    GEBQ01026969    JAT13008.1    GECZ01026895    JAS42874.1    GEBQ01024748    JAT15229.1    AAZX01001175    GEBQ01029952    JAT10025.1    DS235033    EEB10776.1    CVRI01000054    CRL00175.1    AAAB01008984    CRL00174.1    APCN01003786    KQ460890    KPJ11008.1    GFTR01006165    JAW10261.1    APGK01019954    KB740150    KB632173    ENN81251.1    ERL89576.1    JH431845    ACPB03000431    ACPB03000432    QCYY01003988    ROT61799.1    GBBK01002522    JAC21960.1    GFWV01013104    MAA37833.1    GEFM01003286    JAP72510.1    GDKW01003558    JAI53037.1   
Pfam
PF01504   PIP5K
Interpro
IPR027483   PInositol-4-P-5-kinase_C        + More
IPR023610   PInositol-4-P-5-kinase       
IPR002498   PInositol-4-P-5-kinase_core       
IPR027484   PInositol-4-P-5-kinase_N       
Gene 3D
PDB
6CN2     E-value=1.47913e-28,     Score=307

Ontologies

Topology

Length:
95
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.06752
Exp number, first 60 AAs:
0.06751
Total prob of N-in:
0.13953
outside
1  -  95
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号