SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16787
Annotation
PREDICTED:_uncharacterized_protein_LOC106135986_[Amyelois_transitella]
Location in the cell
Extracellular   Reliability : 1.165 Nuclear   Reliability : 1.453
 

Sequence

CDS
ATGACTTCTTATAATTTTAATGATGACATCCAAAACCAACTCATGCGTTTTTGGCAGCTTGAAGAAGTCTGTCCTCAGTCAAATCATTATTTCCCTGAAGAGAAGTTATGCGAAGAACATTTTGTTAAAAATACAACTCGCCTCGCAGACGGACGGTTTTGCGTAAGAATCCCATTGAAACAAGCGCCTGACGTTTTGGGAAGTTCTTATCAGCGAGCTAAACATTGCTTATTATCTTTGGAGCGTCGACTCAAAGGTGATGATTCATTTAGTAAAATGTACAAGGAATTTATGCGCGAGTATAAAAATCTTGGTCACATGTCAGAGTGCAAACCGAATATTGAGTTGCCTCATTACTTCATCCCACATCATGGTGTCCTTCGTGAATGTAGTACGACCACTAAGTTGCGCGTCGTATTTAATGCGAGCAGCCCTACTTCCTCAAGGGTTTCATTTAATGACATTCAAATGATAGGACCCACGGTGCAAGACGATTCTTCTGTCAATTCTTTTACGTTTTCGGCAGCACAATCCACACATCATGTCACTAAGTTATTGTTTGAGTTTGAACACAGAAGATTAATGCATGCAGGCCCTCAACTCCTGTTAGCCACAATTAGAGAAAACTACTGGCCTATAGGCGGTCGTAATTTAGCGAAAAAATGTTACCGTCAGTGTGTGCGTTGCAATCGTATGAAAGGAAAGTCATTCGCTCCGTTAATGGGCAACTTACCGCAGCAGAGACTCGAACCTGGAGGTTACGCATTTGAAAGTGCAGCAGGCGTGGACTATGCCGGTCCCGTTTCCTGCGCTAGTCGTAATGGTCGCGGTTGTAGACTCATCAAGTCGTACATTGCTATTTTTGTGTGCTTCACTACTAAGGCAGTTCATTTAGAATTGGTGGGTAACTTAACAAGCAATAACTATCTATTAGCGTTACGGAGATTTATATCGCGTAGAGGAAAGCCTAGAGACATATTTTCAGACAACGGTACCTCATTCGTTGGCGCATATAATGACCTATCGAAATTTCTCAAAGCCAATTGTGATTCCTTGGCCGCTGATTCGGCACAGGATAACATCAATTTTCATTTTATTCCCGCGTACAGCCCTAATTTCGGAGGTCTTTGGGAGGCAGATAACCAGAGTTGCTGA
Protein
MTSYNFNDDIQNQLMRFWQLEEVCPQSNHYFPEEKLCEEHFVKNTTRLADGRFCVRIPLKQAPDVLGSSYQRAKHCLLSLERRLKGDDSFSKMYKEFMREYKNLGHMSECKPNIELPHYFIPHHGVLRECSTTTKLRVVFNASSPTSSRVSFNDIQMIGPTVQDDSSVNSFTFSAAQSTHHVTKLLFEFEHRRLMHAGPQLLLATIRENYWPIGGRNLAKKCYRQCVRCNRMKGKSFAPLMGNLPQQRLEPGGYAFESAAGVDYAGPVSCASRNGRGCRLIKSYIAIFVCFTTKAVHLELVGNLTSNNYLLALRRFISRRGKPRDIFSDNGTSFVGAYNDLSKFLKANCDSLAADSAQDNINFHFIPAYSPNFGGLWEADNQSC

Summary

Pfam
PF17921   Integrase_H2C2        + More
PF00665   rve
PF05585   DUF1758
PF07679   I-set
PF18701   DUF5641
PF05380   Peptidase_A17
PF03564   DUF1759
PF14291   DUF4371
Interpro
IPR041588   Integrase_H2C2        + More
IPR036397   RNaseH_sf       
IPR001584   Integrase_cat-core       
IPR012337   RNaseH-like_sf       
IPR036259   MFS_trans_sf       
IPR020846   MFS_dom       
IPR003598   Ig_sub2       
IPR036179   Ig-like_dom_sf       
IPR008042   Retrotrans_Pao       
IPR040676   DUF5641       
IPR013098   Ig_I-set       
IPR008737   Peptidase_asp_put       
IPR003599   Ig_sub       
IPR007110   Ig-like_dom       
IPR013783   Ig-like_fold       
IPR005312   DUF1759       
IPR025398   DUF4371       
IPR006580   Znf_TTF       
SUPFAM
SSF53098   SSF53098        + More
SSF103473   SSF103473       
SSF48726   SSF48726       
Gene 3D

Ontologies

Topology

Length:
384
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.66703
Exp number, first 60 AAs:
0
Total prob of N-in:
0.03082
outside
1  -  384
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号