SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16786
Annotation
Putative_115_kDa_protein_in_type-1_retrotransposable_element_R1DM-like_Protein_[Tribolium_castaneum]
Location in the cell
Cytoplasmic   Reliability : 1.621 Mitochondrial   Reliability : 1.857
 

Sequence

CDS
ATGGGCATGGCACAAATTCAAAGCATAGCTGATGGCCTCTTCCCGGAACACATAGATTTCGAACGGAAAACGAAACCGTCACAGGAGTTCCCAGAGGTGACCGAGGAGGAGATCATCCAACTAAAAGCTCGCATAAAGCTCAGGAAAGCCCCAGGGCCCGACCGGATTCCGCCGGAGATAGTGACTCTAGCAGTAGCAGTAATTCCAGACAGGATAAGGCTTGTGTTGCAGAAGGTGCTGGAGTCTGGCGTCTTCCCCAACAGCTGGAAAACAGCCAGACTAGTCCTGCTAAGAAAACCAGGCAAACCCGCTGAAGATCCTGCGGGGCACAGGCCGCTATGTCTACTGGACTGCTACGGAAAGCTGCTGGAGTCGCTGATCCTAGGCAGAATAGAAAAACAACTAGTACAATCGGACTGTTTACAAGATTCGCAGTACGGGTTCAGAAAGGGGAGGTCCACAGTGGATGCAGCCAACAAGCTACTTGAGATAGCGGAAGACGCGAGACGAGGAACCCACCGCACCAGAAGAATCTGCGCAGTAGTGGCCCTCGACGTCCGTAATGCTTTCAATTCTGCATCGTGGGAGCTCATCCTGGAGGAAATGGCTGCAATAGGTATGCCTCAATACATCTATAATATCATAAACAGCTACCTCCAGGACAGATGCATCATACTGACAGACGCTGAGGGAGGGGTTGTAGTGAAAAAGGTTACCGGTGGTGTTCCGCAGGGGTCGATACTGGGCCCCACGCTGTGGAACATACTGTATGATGGGGTACTGCGCCTCGAACTGGGGGATGGGGCACAATTAATAGGCTTCGCGGACGATTTAGCTCTGGTGGTGTCAGCAAAGAAGGAAGCAGAACTAATGGCAATAACGAATGTAGCCCTACAAAAGATCAGCGCTTGGATGAAGCAAAAGCGGCTACACTTGGCCCCAGAAAAGACCGAGGCAATTGTGCTAAGTGGGCGAAGAAAGCTTAGCGAGATTTGCTTTACCCTCCAGGGCGTCAGGGTGGTTCCAACCGACAAACTGAAATACCTCGGGTTTTGGTTTGACAAAAGTCTGAAGTTCGGCAAACACATTGAAGAAACAACTGGTAAAGCCGAAAGACTGACGACCGCCCTTGGCCAAATCATGCCCAGGAAAGGAGGGCCGAGGTCGAGCAAGCGCAGACTATTGGCGTCCGCAATACAATCTGTGATGTTATATGGAGCACCGGTGTGGGCAAAGGTAATGAATGTAGCGAAGTACAGGAACATGTATAGCAAAGTGCAACGACAGCTGGCAATACGCATCTGTGGAGCTTACCGTACCATATCGCTAGACGCCGTCTTGGTGATAGCGGGCCTGATACCGATAGAACGGCTAGCAAAGGAACGGCAACGCTACTACCACGAGGGGACAAGAACGAGAGAAGAGGAAAGAGCACATACAATAAAAGAATGGGAACGAGACTGGCAGAAGGAGGGAAAAGGTAAGTGGACTCGTACAATCATACCCAACCTTAGGCTCTGGATGGAACGGAAACATGGCGAAACCGACAGACTGCTGACACAGGCCCTAAGTGGGCATGGAGTTTTCAACACTTACCTGCATTCAATAGGGAAAGCAGAAAGCGCAAGTTGCCCATACTGCGAACATGTTGATACACCGGAACATGCCCTATTTCAATGCATAAAGTTCACAGAACTAAGAGGGAAAACGGAGGGAAGTGACGGAAAGGTGACTGTGGAAAACCTGATGGTGAGAATGATCCATAGTAAAGAAGAATGGGATAAATATGCGGGAATGCTCAAAGAGATAATGAGAGTGCGGGAAAAGGACGAAAGACTAAGGCAAGAATCTATCTATAATAATATATAA
Protein
MGMAQIQSIADGLFPEHIDFERKTKPSQEFPEVTEEEIIQLKARIKLRKAPGPDRIPPEIVTLAVAVIPDRIRLVLQKVLESGVFPNSWKTARLVLLRKPGKPAEDPAGHRPLCLLDCYGKLLESLILGRIEKQLVQSDCLQDSQYGFRKGRSTVDAANKLLEIAEDARRGTHRTRRICAVVALDVRNAFNSASWELILEEMAAIGMPQYIYNIINSYLQDRCIILTDAEGGVVVKKVTGGVPQGSILGPTLWNILYDGVLRLELGDGAQLIGFADDLALVVSAKKEAELMAITNVALQKISAWMKQKRLHLAPEKTEAIVLSGRRKLSEICFTLQGVRVVPTDKLKYLGFWFDKSLKFGKHIEETTGKAERLTTALGQIMPRKGGPRSSKRRLLASAIQSVMLYGAPVWAKVMNVAKYRNMYSKVQRQLAIRICGAYRTISLDAVLVIAGLIPIERLAKERQRYYHEGTRTREEERAHTIKEWERDWQKEGKGKWTRTIIPNLRLWMERKHGETDRLLTQALSGHGVFNTYLHSIGKAESASCPYCEHVDTPEHALFQCIKFTELRGKTEGSDGKVTVENLMVRMIHSKEEWDKYAGMLKEIMRVREKDERLRQESIYNNI

Summary

EMBL
KQ972160    EFA13619.2    KQ971309    EEZ99146.1    GEHC01000964    JAV46681.1    + More
ABLF02041886    AB593323    BAK38643.1    AB593321    BAK38639.1    AB593325    BAK38646.1    KU543683    AMS38371.1    GALA01001776    JAA93076.1    GALA01000302    JAA94550.1    GALA01001777    JAA93075.1    GFXV01003903    MBW15708.1    KQ971388    KYB24913.1    GALX01005145    JAB63321.1    GEHC01000915    JAV46730.1    KQ972226    KYB24577.1    GAPW01000192    JAC13406.1    ABLF02041557    GALX01004785    JAB63681.1    AB593324    BAK38644.1    KQ972691    KXZ75806.1    KQ972544    KXZ75870.1    KXZ75869.1    KQ971310    KYB29500.1    KYB29499.1    KXZ75807.1    GGFK01005660    MBW38981.1    GGFL01004044    MBW68222.1    ABLF02021100    GFTR01008427    JAW07999.1    APGK01005465    KB736249    ENN83233.1    GAMC01020519    GAMC01020515    JAB86040.1    GAMC01020517    JAB86038.1    GFXV01002090    MBW13895.1    GGFJ01001727    MBW50868.1    GAKP01002292    JAC56660.1    GGFJ01001369    MBW50510.1    GGFL01004046    MBW68224.1    KU543679    AMS38363.1    GGFJ01001370    MBW50511.1    GGMR01011682    MBY24301.1    ABLF02016340    GGFL01001583    MBW65761.1    ABLF02004674    ABLF02004675    ABLF02004676    ABLF02011637    ABLF02011183    ABLF02041884    ABLF02034925    AAZX01012143    AAZX01012194    ABLF02018942    ABLF02041885    GGFL01004047    MBW68225.1    AB593326    BAK38647.1    GGFJ01001439    MBW50580.1    GGFJ01001454    MBW50595.1    GGFJ01001453    MBW50594.1    KU543682    AMS38369.1    HACL01000281    CFW94575.1    AB090817    BAC57910.1    GDHF01029467    GDHF01011533    JAI22847.1    JAI40781.1    ABLF02010223    AB090812    BAC57900.1    AB593327    BAK38648.1    AB090815    BAC57906.1    APGK01033685    KB740885    ENN78512.1    ABLF02009991    ABLF02009992    ABLF02054952    AB593322    BAK38641.1    GGMR01000779    MBY13398.1    GEBQ01030504    JAT09473.1    GFTR01007160    JAW09266.1    GALX01004171    JAB64295.1    GDHC01002080    JAQ16549.1    AB090819    BAC57914.1    KQ973256    KXZ75595.1    GGMR01004600    MBY17219.1    M93691    AAA29365.1    ABLF02013358    ABLF02013361    ABLF02054869    GGFM01001554    MBW22305.1    ABLF02009073    ABLF02030702    ABLF02042963    GGFJ01001164    MBW50305.1    GGFJ01001165    MBW50306.1    KXZ75805.1    GGMR01006838    MBY19457.1    AB090814    BAC57904.1    KQ972255    KYB24568.1    GGFL01001192    MBW65370.1    APGK01020183    KB740172    ENN81190.1    GGFJ01001166    MBW50307.1    KQ971675    KYB24771.1    AB090813    BAC57902.1    ABLF02015311    ABLF02015320    ABLF02034009    ABLF02043484    GGFK01007771    MBW41092.1    ABLF02005203    ABLF02041316    AB090821    BAC57918.1    GGMR01019493    MBY32112.1    AB090823    BAC57922.1    AB090820    BAC57916.1    ABLF02014650    GGFL01001190    MBW65368.1    AB090816    BAC57908.1    GGFL01001189    MBW65367.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF00098   zf-CCHC
PF13966   zf-RVT
PF12017   Tnp_P_element
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR036875   Znf_CCHC_sf       
IPR001878   Znf_CCHC       
IPR000663   Natr_peptide       
IPR026960   RVT-Znf       
IPR016067   S-AdoMet_deCO2ase_core       
IPR021896   Transposase_37       
SUPFAM
SSF56219   SSF56219        + More
SSF57756   SSF57756       
SSF56276   SSF56276       
Gene 3D
PDB
6AR3     E-value=0.00874827,     Score=94

Ontologies

Topology

Length:
622
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
14.22548
Exp number, first 60 AAs:
0.00021
Total prob of N-in:
0.00567
outside
1  -  622
 
 

Population Genetic Test Statistics

Pi
0.241085
Theta
0.245856
Tajima's D
-0.167928
CLR
0
CSRT
0.502924853757312
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号