SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16782
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.757 Nuclear   Reliability : 1.544
 

Sequence

CDS
ATGCGATCGGCCATGGATAAACTCAGAAAAGTATGGAAGGACCGGAATATCACCAAGACTACCAAAGTCCGACTGGTAAGGGCACTGGTGTTCCCCATCTTTTTATATGGGGTTGAGACCTCGACTGTGAAAGAAAGAGAAAAAAGAAGGATCGATGCATTAGAAATGTGTTGCTGGAGAAGGATGCTCCTGAAAAATACTGTGTAA
Protein
MRSAMDKLRKVWKDRNITKTTKVRLVRALVFPIFLYGVETSTVKEREKRRIDALEMCCWRRMLLKNTV

Summary

EMBL
RSAL01000427    RVE41762.1    FJ265552    ADI61820.1    FJ265560    ADI61828.1    + More
RSAL01000235    RVE43733.1    FJ265547    ADI61815.1    FJ265553    ADI61821.1    FJ265557    ADI61825.1    FJ265546    ADI61814.1    ODYU01001007    SOQ36619.1    LBMM01011957    KMQ86521.1    KZ150203    PZC72267.1    BDOT01000134    GCF52480.1    RSAL01000289    RVE42931.1    ODYU01003523    SOQ42419.1    BDOT01000005    GCF41524.1    FJ265548    ADI61816.1    MKPU01000878    OIR55924.1    BDSA01000081    GBE63537.1    LK054988    CDR71535.1    NCKU01012182    RWS00163.1    NCKU01008836    RWS01655.1    BDOT01000373    GCF57844.1    NCKU01006316    RWS03634.1    BDOT01000018    GCF44776.1    BDOT01000015    GCF44366.1    BDOT01000020    GCF44950.1    BDOT01000141    GCF52733.1    BDOT01000123    GCF52043.1    BDOT01000008    GCF42803.1    GCF52511.1    NCKU01003098    RWS08177.1    BDOT01000039    GCF47390.1    GCF47350.1    GCF41529.1    GCF44758.1    GCF44165.1    BDOT01000163    GCF53401.1    BDOT01000385    GCF57999.1    BDOT01000082    GCF50401.1    BDOT01000282    GCF56465.1    BDOT01000090    GCF50896.1    BDOT01000055    GCF48663.1    BDOT01000051    GCF48398.1    GCF52736.1    GCF41659.1    BDOT01001107    GCF61669.1    BDOT01000006    GCF41929.1    GCF42880.1   
Pfam
PF02146   SIR2        + More
PF00078   RVT_1
PF14529   Exo_endo_phos_2
PF03392   OS-D
PF03372   Exo_endo_phos
Interpro
IPR029035   DHS-like_NAD/FAD-binding_dom        + More
IPR003000   Sirtuin       
IPR026590   Ssirtuin_cat_dom       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR005055   A10/PebIII       
IPR036682   OS_D_A10/PebIII_sf       
IPR002138   Pept_C14_p10       
IPR016024   ARM-type_fold       
IPR017956   AT_hook_DNA-bd_motif       
IPR039776   Pds5       
SUPFAM
SSF52467   SSF52467        + More
SSF56219   SSF56219       
SSF100910   SSF100910       
SSF48371   SSF48371       
Gene 3D

Ontologies

Topology

Length:
68
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
9.09635
Exp number, first 60 AAs:
9.09635
Total prob of N-in:
0.86951
inside
1  -  68
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号