SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16779
Pre Gene Modal
BGIBMGA002877
Annotation
PREDICTED:_uncharacterized_protein_LOC105842347_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.499 Nuclear   Reliability : 1.99
 

Sequence

CDS
ATGAATGGCGAAGAAGACATAGCATTCATAGACGTAGCCTCTAACTCGATGGCGAAATTGCCAGAAAAAGGTATCCTGAAGAAGCACGGGTACGGAGCTGTGGATGGGAAGGACAAATGGGGAGACGACTCGCAGTCGGAGCAGCTCGAGGCTGGCTCGCAGTCCGATGGGCAGGAACCGGCAGGGGCTGTTGCCGATATGGAATACAAGTTTAAGGATCTGAACGGCTATCACGAGAACATAATAGTGGCCTTGAAGACGGCCGCGGCGCAACGTGCGAGCGCTGCAGGAGGCTCCGGTGATCTTCGCTCCCTCCAGGACTACGAGTACAAGGAGCGGAGGGAACGAGCCCCCAGCGCAGAGAAGATCCACGACGCGGAACTGCGAAGACAGCGCCCCGACGACGAAGAGGACGACGCTCCACAGTGCGCCCCATCAGAATCAGGAACCTGGAGGACTTGA
Protein
MNGEEDIAFIDVASNSMAKLPEKGILKKHGYGAVDGKDKWGDDSQSEQLEAGSQSDGQEPAGAVADMEYKFKDLNGYHENIIVALKTAAAQRASAAGGSGDLRSLQDYEYKERRERAPSAEKIHDAELRRQRPDDEEDDAPQCAPSESGTWRT

Summary

Pfam
PF08516   ADAM_CR        + More
PF00200   Disintegrin
PF07974   EGF_2
PF01421   Reprolysin
PF01562   Pep_M12B_propep
Interpro
IPR006586   ADAM_Cys-rich        + More
IPR013111   EGF_extracell       
IPR036436   Disintegrin_dom_sf       
IPR000742   EGF-like_dom       
IPR024079   MetalloPept_cat_dom_sf       
IPR001590   Peptidase_M12B       
IPR001762   Disintegrin_dom       
IPR013032   EGF-like_CS       
IPR034027   Reprolysin_adamalysin       
IPR018358   Disintegrin_CS       
IPR002870   Peptidase_M12B_N       
SUPFAM
SSF57552   SSF57552       
Gene 3D

Ontologies

Topology

Length:
153
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00054
Exp number, first 60 AAs:
0
Total prob of N-in:
0.07330
outside
1  -  153
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号