SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16743
Annotation
PREDICTED:_uncharacterized_protein_LOC101742912_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.397
 

Sequence

CDS
ATGGACAATACTATCCCGAAAGACCTGGAAGTCATAGTGGACAAACCGTCAACAGTAAGGCGGAGTATTGAAAATATTGAGGCAAGCCAGGAGGCAGCACAAATAGAAGTCCAACCCTCCCAAAAAAGGATCCAAGCGATCAAATCCAGCCAGAAGGAGGCAACCAGGAAAATAGACCTGGTTACGTCACCTCCAACAAGGGAGAAACACCCAACCCTGGCTCTTGAAGCTAAATCCTGTCTTTGCAAGGCGAAGACTTATCTGGCCAACTCCAGAAACCTGAGGACGGACATAAAGGACGGAGTCTTGAATACAATCGATAGACTGTACCAAATAGTCAAAACTTTGGATAAAGAATTGGAAAATCAAAAAAGAGGAAAGAAAGAGGAGGAGAAAGGAGTAGGGACGGGGTCAAGAAACATGCCTAAGGCGAGCACAACCAGGAAATGTAACACCAGGGACGTGAATTGGCTACCTTTTATTGAAAAGGCAACCCAATTCAAGAGGGACAAAAATCTTGACACTCAAAGATTGAAAATGACAAACACGGAGGAAGAACGAACGAATACCATAAACGAGTATGATGCAGTTGTGATCGAGGCGCACGAGGAGGTCTTCCAAAAATAA
Protein
MDNTIPKDLEVIVDKPSTVRRSIENIEASQEAAQIEVQPSQKRIQAIKSSQKEATRKIDLVTSPPTREKHPTLALEAKSCLCKAKTYLANSRNLRTDIKDGVLNTIDRLYQIVKTLDKELENQKRGKKEEEKGVGTGSRNMPKASTTRKCNTRDVNWLPFIEKATQFKRDKNLDTQRLKMTNTEEERTNTINEYDAVVIEAHEEVFQK

Summary

Uniprot
Pfam
PF06472   ABC_membrane_2
Interpro
IPR011527   ABC1_TM_dom        + More
IPR031241   ABCD3       
ProteinModelPortal

Ontologies

Topology

Length:
208
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.08171
outside
1  -  208
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号