SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16740
Annotation
PREDICTED:_uncharacterized_protein_LOC101741146_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 0.945 Nuclear   Reliability : 0.945
 

Sequence

CDS
ATGTCGGTGGCGACGGCGGCATCTAAGCTCAATAAGTCGGAGGACGGGCCCTGGTGGGGTCCCGAGGTCCATTGGGGCCTCTCAGGGCCTTCCTTGGCATTCTACCCGTCCGAGGGCAATGCGGAACTGAAGACAGCTGAGGACACAAAGAAAGAGGTAAAAAAGGCCATTGACCCTAAGTCAATGGCTATTGGAATACAGAGCGTAAGGAAGGTTGGGAATGCGGGGGTAGTGGTGCAGACCGTCCCCGCGGCCGCAGTCAAGCTTAGAAATGCTGCCCCGCCATCACTGAGAGTCACCGAACCCAGGCGCCGACAGCCCTTAGTAGCTGTCAATGGCGTGGAGGGCGACCCCTCCTTCGAGGAGGTAATCGAGTGCCTGGCTAGCCAGAACCTCGACCCGGAGGAGTGGCCCCTCACTAGGGTACGAGCGGAGCTCACGGGGGCGTTCAAAAAGGGGAGGCGACAATCCAACAACACTACTGTGGTGTTTAACGCCTCCCCTCGCATCAGGGACGCCCTCGTGAAGATTGGCAGAGTGTATGTGGGGGGGTCGCCTGAGGTCACGGACTTTGTCCGGGTGACCTGCTGCAATAAGTGTCAGCAATATGGTCACCCGGAGAAATTTTGCCGGGCCAAGGAGGCCACCTGGCCGATGTGGAGAGGATGGCCACCGAATGGAGGCCTATCGCGTATCCACGAGCGAATGGGGAGTCTGGACCTCGAGGAACCTGTGGCTGCCCTTTGCGAAAAATTTACCGGGGTTATAACTCGCACAGCTGAAGAATGCTTAGGATCACTGAAAGCAGATAGAACTGACAGGGGTTATGAGTGGTGGACCCCAGTACTCGATAAGCTTAGGGTAGCCCAGGGTAGGGCCAGGCGTCGATGGCAAAAGGCCCGCCGAACGGGGGGTGAGGAAGAGGAGCAGTCTGGGAGAGTCTTCCGCGACCGCAGGCGCGAGTATCGAAGAGCGATGCATGACGCTGAGACCGCCTTTTACCGGGAGATCGCTGAAGGGGAAACCGTGACCCGCCAAGCGGAACTGTCCGCCCAACATCTATCGGATGCTGACGGACTATTTCCGCGGACGCCGTATTGCCGTTGTCGCGGGGGAATGTGCGGAATGGAAGGTGTCCACGATGGGCTGTCCGCAGGCTCAGTGCTCGGGCCGACGCTCTGGAACGTTCTGATGGATGACCTGCTCGCCTTGCCGCAGGGGATAGAGGGAACAGAGATGGTCGCCTATGCCGATGACGTGACGGTACTGGTTAGGGGTGACTCACGGCGCAGCTTGAGAGGAGAGCGCACGCCGTGCTAG
Protein
MSVATAASKLNKSEDGPWWGPEVHWGLSGPSLAFYPSEGNAELKTAEDTKKEVKKAIDPKSMAIGIQSVRKVGNAGVVVQTVPAAAVKLRNAAPPSLRVTEPRRRQPLVAVNGVEGDPSFEEVIECLASQNLDPEEWPLTRVRAELTGAFKKGRRQSNNTTVVFNASPRIRDALVKIGRVYVGGSPEVTDFVRVTCCNKCQQYGHPEKFCRAKEATWPMWRGWPPNGGLSRIHERMGSLDLEEPVAALCEKFTGVITRTAEECLGSLKADRTDRGYEWWTPVLDKLRVAQGRARRRWQKARRTGGEEEEQSGRVFRDRRREYRRAMHDAETAFYREIAEGETVTRQAELSAQHLSDADGLFPRTPYCRCRGGMCGMEGVHDGLSAGSVLGPTLWNVLMDDLLALPQGIEGTEMVAYADDVTVLVRGDSRRSLRGERTPC

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
439
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00988999999999998
Exp number, first 60 AAs:
0.00012
Total prob of N-in:
0.00624
outside
1  -  439
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号