SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16737  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA012740
Annotation
PREDICTED:_peroxidase-like_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 1.667 PlasmaMembrane   Reliability : 1.624
 

Sequence

CDS
ATGCTCTGGTCATTAGTTTTCTTGGCGTTTCTGAAGCTGACCGCCGGTGTTCGCTATGAATCGTTTTCTGGTCTACCAGCGACTGATGAAAAGATCCAATACTTCATCAAACAGGAAAATTTAGATAACTGCACCAATGACATTCAACTCCCCTGCGACCCCAATGAGAGACGACGTCTAGATGGCTCATGCAGTAATTTCGACTATCCGTCAAGAGGAACATTCCATACCCCTGTGATAAGATTGTTACCCGAAGCCGACTGTGGAGACGATGAAACCTCTCCATCTGGAGCTCCTTTAAAATCTGCCCGGGAAGTCAGGCAGCGTATTTTACAGACAGGGAAGGCATCAGACCTCTCATACACACAACTATTGGCGATTATCTCGACAATCATATTTGCTGACCTTGGTTCAATCCATGATTCCGTGAATTTGTTAACGGAGACCACAAATTGTTGCACAGCGGAAGGAAAATCAAATTATATGTGCACGCCTATAGATATTCCCCAGGACGACCCTGTCCATAGGTTCTCTGGTATACGCTGCTTGAATCTCACTCGACCGAAATCGTTCCAGACTTATGGCTGCCTTGCTGACTCGAATGTAGACAGAATCGAATTCACAACACCGTTATTTGATTTATCGACTATCTACCGATCGACCGAACCGGCTCCAGAATACAGAACATACAGTGGCGGATTACTGATGACCCAAGAGGCCGATGGCACCATCTTCCCCCCACAAGAAGGACCGCACAGCAATAAATGCTTGCAAAACGACGCGTCTAATGGAGAAACGAAATGTTTTGGCCCTGTTTCAACATCGATTCTGCCGGTCACATTGTTGGTCGTGTGGTGGTGGAGACTACACAATAAGATCGCCAAAGAACTAACGAAATCAATCCTCATTGGGATGACGAAACATTGTTCCAAACTGCAAGGGACATTAACATCGCAATAA
Protein
MLWSLVFLAFLKLTAGVRYESFSGLPATDEKIQYFIKQENLDNCTNDIQLPCDPNERRRLDGSCSNFDYPSRGTFHTPVIRLLPEADCGDDETSPSGAPLKSAREVRQRILQTGKASDLSYTQLLAIISTIIFADLGSIHDSVNLLTETTNCCTAEGKSNYMCTPIDIPQDDPVHRFSGIRCLNLTRPKSFQTYGCLADSNVDRIEFTTPLFDLSTIYRSTEPAPEYRTYSGGLLMTQEADGTIFPPQEGPHSNKCLQNDASNGETKCFGPVSTSILPVTLLVVWWWRLHNKIAKELTKSILIGMTKHCSKLQGTLTSQ

Summary

EMBL
BABH01034746    BABH01034747    ODYU01007479    SOQ50286.1    ODYU01007325    SOQ50002.1    + More
KZ149907    PZC78258.1    RSAL01000046    RVE50539.1    ODYU01007226    SOQ49823.1    NWSH01002854    PCG67434.1    BABH01034743    BABH01034744    NWSH01006580    PCG63355.1    AK401278    BAM17900.1    ODYU01005947    SOQ47370.1    KQ459324    KPJ01646.1    AGBW02012596    OWR44740.1    KQ460416    KPJ14923.1    ODYU01004596    SOQ44641.1    PZC78257.1    KPJ01647.1    KPJ01645.1    BABH01028746    BABH01028747    BABH01028748    ODYU01007063    SOQ49501.1    PZC78259.1    KQ460685    KPJ12919.1    KJ995811    AIN39494.1    RSAL01000538    RVE41417.1    KQ459564    KPI99614.1    RSAL01000094    RVE47835.1    KZ149956    PZC76461.1    NWSH01001320    PCG71707.1    NWSH01001116    PCG72532.1    PZC76464.1    RSAL01000273    RVE43156.1    PCG72533.1    NWSH01006414    PCG63451.1    PZC76463.1    NWSH01006200    PCG63597.1    ODYU01000046    SOQ34155.1    GGFK01004863    MBW38184.1    GGFK01004599    MBW37920.1    ADMH02000540    ETN66033.1    NEVH01006567    PNF37876.1    GGFL01015608    MBW79786.1    GGFK01000169    MBW33490.1    GGFJ01003549    MBW52690.1    ETN66034.1    EU934306    ACI30084.1    AF118391    AAD22196.1    RSAL01000011    RVE53586.1    ODYU01005682    SOQ46784.1    BABH01009341    GGFK01000027    MBW33348.1    GGFK01000023    MBW33344.1    GGFK01000024    MBW33345.1    KK852427    KDR24107.1    JH429957    MH606240    AXM43807.1    GGFK01000125    MBW33446.1    PYGN01001533    PSN34226.1    KJ995807    AIN39490.1    NWSH01001238    PCG72011.1    KM384736    AIO11227.1    GBYB01000656    JAG70423.1    KT825861    AMN85760.1    GDIP01069925    JAM33790.1    GDIQ01267596    JAJ84128.1    GDIP01040529    JAM63186.1    GDIP01109325    JAL94389.1    GDIP01127616    JAL76098.1    GDIP01163415    JAJ59987.1    GDIP01050634    JAM53081.1    GDIP01203711    JAJ19691.1    GDIP01253153    GDIP01251953    GDIP01201971    GDIP01176159    GDIP01160066    GDIP01140068    GDIP01095332    GDIP01094076    GDIP01074225    JAL63646.1    GDIQ01041401    JAN53336.1    GDIP01253503    GDIP01220810    GDIP01184165    GDIP01167363    GDIP01166614    GDIP01156067    GDIP01153368    GDIP01137919    GDIP01092221    GDIP01088322    GDIP01065029    JAJ70034.1    GDIQ01208932    JAK42793.1    GDIQ01097974    JAL53752.1    GDIP01237962    GDIP01232011    GDIP01221860    GDIP01199311    GDIP01148369    GDIP01097628    GDIP01084673    GDIP01072781    GDIP01062579    JAJ75033.1    GDIP01125618    GDIP01122117    JAL81597.1    GDIP01218159    JAJ05243.1    GDIP01253003    GDIP01134420    GDIP01133121    GDIP01045678    JAI70398.1    GDIP01240365    GDIP01131870    JAL71844.1    GDIP01239257    GDIP01205868    GDIP01149718    GDIP01141176    GDIP01044133    JAM59582.1    GDIP01233156    JAI90245.1   
Pfam
PF03098   An_peroxidase
Interpro
IPR010255   Haem_peroxidase_sf        + More
IPR029585   Pxd-like       
IPR019791   Haem_peroxidase_animal       
IPR037120   Haem_peroxidase_sf_animal       
SUPFAM
SSF48113   SSF48113       
Gene 3D

Ontologies

Topology

SignalP
Position:   1 - 16,         Likelihood:  0.982412
 
 
Length:
319
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
2.70204
Exp number, first 60 AAs:
0.04631
Total prob of N-in:
0.00739
outside
1  -  319
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
24093152 SNVPHDPVR 100.00 3e-07
27102218 IPPYVDYVK 100.00 3e-07
28467696 SNVSSTIPSGQISNVPWR 100.00 3e-07
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号