SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16731
Annotation
PREDICTED:_uncharacterized_protein_LOC106105382_isoform_X2_[Papilio_polytes]
Location in the cell
PlasmaMembrane   Reliability : 4.72
 

Sequence

CDS
ATGAGAGGCTTGAGGTTAGCCACCAGAGACACTGATGCTTTTACGGATCATGCCTTTGAGGTTATCAGAGATGAAATAAACTCAAGCTTACTCCAACCGGAGCTCAGTGATGTTGTGGTCAAGATACCGGGGTCGGTGTCCGTTTCCAATAGGAGGGTCAGCTTCGTGGTGTTCAGAACTGACCGCGCCTTCAGAAATCCAGGGTCCGAGTATTCCGTGAACAGCAGAGTCGTCAGCATCAAGATAGGGAACCTGACGCGGTTTCAAAACGAGGAGTATGATTGTAATTTTACTGATGATGTTAATGTTAAAAGCAAGAGTGTCATGATCCTGGGAGACTCCATCGGCTGCAGTGCTATCAAACGTCCAACAAATGACTGTCGTTTGTTCCAGTTTATCGACATTTATCTGAATCCAATAGTGGAACTGCGCGGGAGCAAGCAAAAGCGAGTTTGCGCGTACTGGGAGTTCCTAGAGGACGGAACAGGGTACTGGTCACAGGACGGATGTGTTCTGATGCGCTCTGAAGATGAAGGGATGCTGGATTACTGCCGATGCACTCATCTGACACACTTCGCTGAGATTCTCATACCTAGGACGTCCTTCTCTGACGCCCACGAAAACGCTCTCGAGCTGATCTCTGTGATCGGCTGCTGTGTCTCCATTTTAGGGCTGGTCTTGGTCGCCATCACCGCGATCCTCTTCAGGTCCTGGCGCCGGGATTTCACCAACAAAATCTGGCTGCAGCTCTGCCTCGCTATATTCATAACCAGCGTCTGCTTCCTCGTCATCGTGTTCGCTGACTTCCTGGAGTACAACATCGCTTGCATGCTGGTCGGGGTTTTGTTGCACTACGCTGTCTTGGCGTCCTTCTGTTGGATGCTGGTCGCAGCTATCATTTCGTATAGGAAACTGGTGATAGTGTTCTCCAGAGACGCTTCGCACAAGCTGCTGAAGGCGTCCGCGTTTTCGTGGGGAGCTCCGTGTGCCGTGGTCGGCGTGCTTCTGTCGGTTCGCTCCGCACTCGTACGCGGGACAATTCGACGGAGACGTTCGCAGCGGGGCCTTCTGCTATCCTCGGGGCTGTCGTTGTGGCTGACGGTGTACGCTCCCATCGCCGTGATGCTGCTGGTGAACTGGACGTTATTCCTCCTGATAGTGCGCTCCGTGTTCGCTTCCCGAAGGATCCAGAGGCACGGGGACTCGAACGAGGCCGCTCCGTTGTGCGTCCGTCTCCTGTCTTCTGGTCTTCTTGTTCGGTCTGCCGTGGGTCTTCGGTTTGTTCCTGAACAACATCGTCACGGTGTACTTGTTCAACTTGACCGCGACCTTTCAAGGTTTCGTGCTGTTCCTCTTCTTTGTCCCGGCAATAAGAAGACCAGGGATCTGTGGTTGAACAAGTTGAAGATCAAGCAGACGCGCAAGGTTCCGGTCACGTCCTCGACGTATACGAATAGGAGCACCGGTGGAAACCCTGGCTCCAGGGTAGGGAACACAAGTGTACCTGCGCAATCCAAAGAGACCAAGCCCAGGTCTATGTCTTCCAGTGACGACTCAAGGTTCTCTTGA
Protein
MRGLRLATRDTDAFTDHAFEVIRDEINSSLLQPELSDVVVKIPGSVSVSNRRVSFVVFRTDRAFRNPGSEYSVNSRVVSIKIGNLTRFQNEEYDCNFTDDVNVKSKSVMILGDSIGCSAIKRPTNDCRLFQFIDIYLNPIVELRGSKQKRVCAYWEFLEDGTGYWSQDGCVLMRSEDEGMLDYCRCTHLTHFAEILIPRTSFSDAHENALELISVIGCCVSILGLVLVAITAILFRSWRRDFTNKIWLQLCLAIFITSVCFLVIVFADFLEYNIACMLVGVLLHYAVLASFCWMLVAAIISYRKLVIVFSRDASHKLLKASAFSWGAPCAVVGVLLSVRSALVRGTIRRRRSQRGLLLSSGLSLWLTVYAPIAVMLLVNWTLFLLIVRSVFASRRIQRHGDSNEAAPLCVRLLSSGLLVRSAVGLRFVPEQHRHGVLVQLDRDLSRFRAVPLLCPGNKKTRDLWLNKLKIKQTRKVPVTSSTYTNRSTGGNPGSRVGNTSVPAQSKETKPRSMSSSDDSRFS

Summary

Similarity
Belongs to the G-protein coupled receptor 2 family.
Pfam
PF01825   GPS        + More
PF00002   7tm_2
Interpro
IPR000203   GPS        + More
IPR017981   GPCR_2-like       
IPR000832   GPCR_2_secretin-like       
IPR016187   CTDL_fold       
SUPFAM
SSF56436   SSF56436       

Ontologies

Topology

Length:
522
Number of predicted TMHs:
5
Exp number of AAs in TMHs:
113.69066
Exp number, first 60 AAs:
0.00032
Total prob of N-in:
0.70180
inside
1  -  212
TMhelix
213  -  235
outside
236  -  244
TMhelix
245  -  267
inside
268  -  278
TMhelix
279  -  301
outside
302  -  320
TMhelix
321  -  343
inside
344  -  355
TMhelix
356  -  378
outside
379  -  522
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号