SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16724
Pre Gene Modal
BGIBMGA014537
Annotation
PREDICTED:_uncharacterized_protein_LOC101742912_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.845
 

Sequence

CDS
ATGGACAATACTATCCCGAAAGACCTGGAAGTCAAAGTGGACAAACCGTCAACAGTAAGGCGGAGTATTGAAAATATTGAGGCAAGCCAGGAGGCAGCACAAATAGAAGTCCAACCCTCCCAAAAAAGGATCCAAGCGATCAAATCCAGCCAGAAGGAGGCAACCAGGAAAATAGACCTGGTTACGTCACCTCCAACAAGGGAGAAACACCCAACCCTGGCTCTTGAAGCTAAATCCTGTCTTTGCAAGGCGAAGACTTATCTGGCCAACTCCAGAAACCTGAGGACGGACATAAAGGACGGAGTCTTGAATACAATCGATAGACTGTACCAAATAGTCAAAACTTTGGATAAAGAATTGGAAAATCAAAAAAGAGGAAAGAAAGAGGAGGAGAAAGGAGTAGGGACGGCATGGCACACCATCCCGCAGTCACAGTCGGTTGGGATGCTCGGCTGCGGTGGCGTACCAACGTTTCAGATTGTGAGAGAAGATGGGGTGCTTAGCAGTGTGGTCCACGTCGCTTACTGCTCCGGTCACAACTGTATCATGCTTACTCTAACGAAGGAAGGGTCAAGAAACATGCCTAAGGCGAGCACAACCAGGAAATGTAACACCAGGGACGTGAATTGGCTACCTTTTATTGAAAAGGCAACCCAATTCAAGAGGGACAAAAATCTTGACACTCAAAGATTGAAAATGACAAACACGGAGGAAGAACGAACGAATACCATAAACGAGTATGATGCAGTTGTGATCGAGGCGCACGAGGAGGTCTTCCCAAAAATAAAATGTAAAACAAATCCGAAGATTCCTTGGTGGACCAAAGAGTTGGAGGATAAGGAAAAGGAAACACTTACCTTAGAGTGGCGGGTCCGCTGCACGGAACCCTGCAGTAGGAGTGCCGCCGCAGCCGGGTATCTGGAACAAAAAGAGGACTGTGGAAATGATGTGAAGGGTGCTGAGAGAAGCAGTTGGATGGAGTTTGATTTTGCAAAATTGGAACAACTTACTGTCAAGACTAGATAA
Protein
MDNTIPKDLEVKVDKPSTVRRSIENIEASQEAAQIEVQPSQKRIQAIKSSQKEATRKIDLVTSPPTREKHPTLALEAKSCLCKAKTYLANSRNLRTDIKDGVLNTIDRLYQIVKTLDKELENQKRGKKEEEKGVGTAWHTIPQSQSVGMLGCGGVPTFQIVREDGVLSSVVHVAYCSGHNCIMLTLTKEGSRNMPKASTTRKCNTRDVNWLPFIEKATQFKRDKNLDTQRLKMTNTEEERTNTINEYDAVVIEAHEEVFPKIKCKTNPKIPWWTKELEDKEKETLTLEWRVRCTEPCSRSAAAAGYLEQKEDCGNDVKGAERSSWMEFDFAKLEQLTVKTR

Summary

Uniprot
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
SUPFAM
SSF56219   SSF56219       
Gene 3D
ProteinModelPortal

Ontologies

GO

Topology

Length:
341
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0235
Exp number, first 60 AAs:
0
Total prob of N-in:
0.02173
outside
1  -  341
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号