Pre Gene Modal
BGIBMGA012706
Annotation
PREDICTED:_X-linked_retinitis_pigmentosa_GTPase_regulator-like_isoform_X1_[Bombyx_mori]
Full name
X-linked retinitis pigmentosa GTPase regulator
Location in the cell
Cytoplasmic Reliability : 1.155 Extracellular Reliability : 1.327
Sequence
CDS
ATGCTTTCTTGGTACACAGAGAATGGTCGTGTGTTTGTGTTCGGAGCTAACACGTGGGGTCAGCTGGGCCTTGGTCATAAAGATGAGGTGACGCGGCCTAGTTGCGTGAAATGGCTCAAACCGCAGCGAACAATGTTCGTTGCGTGCGGACGAGCGCACACCGTTTTCGTTACAGAAACAAACGCTATATACACCGTGGGCTGCAACGATGAGGGGCAGCTCGGCACCGGCGATATGGAACACAGCACAGTTCCGCAAAGTGTCGAACTTGAGGAGCCCATAGTCGTGAAACAGATATCCGCTGGAAGCAACCACACGGCCTCTACTGACTGGTGGGTTTTTAATAAATGGCCTTGA
Protein
MLSWYTENGRVFVFGANTWGQLGLGHKDEVTRPSCVKWLKPQRTMFVACGRAHTVFVTETNAIYTVGCNDEGQLGTGDMEHSTVPQSVELEEPIVVKQISAGSNHTASTDWWVFNKWP
Summary
Description
Could be a guanine-nucleotide releasing factor. Plays a role in ciliogenesis. Probably regulates cilia formation by regulating actin stress filaments and cell contractility. May be involved in microtubule organization and regulation of transport in primary cilia. Plays an important role in photoreceptor integrity. May play a critical role in spermatogenesis and in intraflagellar transport processes.
Could be a guanine-nucleotide releasing factor (By similarity). Plays a role in ciliogenesis (By similarity). Probably regulates cilia formation by regulating actin stress filaments and cell contractility (By similarity). May be involved in microtubule organization and regulation of transport in primary cilia (By similarity). Plays an important role in photoreceptor integrity. Isoform 5 may play a critical role in spermatogenesis and in intraflagellar transport processes.
Subunit
Interacts with PDE6D (By similarity). Interacts with RPGRIP1 (By similarity). Interacts with RPGRIP1L (By similarity). PDE6D, RPGRIP1 and RPGRIP1L may compete for the same binding sites (By similarity). Interacts with NPM1 (By similarity). Interacts with SMC1A and SMC3 (By similarity). Interacts with CEP290 (By similarity). Interacts with WHRN (By similarity). Interacts with SPATA7 (By similarity).
Interacts with SPATA7 (PubMed:29899041). Interacts with PDE6D (PubMed:9990021). Interacts with RPGRIP1 and RPGRIP1L; PDE6D, RPGRIP1 and RPGRIP1L may compete for the same binding sites (By similarity). Interacts with NPM1 (By similarity). Interacts with PDE6D. Isoform 5 interacts (via N-terminus) with SMC1A and SMC3 (PubMed:16043481). Isoform 5 interacts with CEP290 (PubMed:16632484). Interacts with WHRN (PubMed:22323458).
Miscellaneous
Male transgenic mice carrying multiple copies of the Rpgr transgene are infertile showing normal mating but no progeny; these mice also exhibit reduced sperm numbers as well as morphological and functional defects in the sperm flagellum.
Male BL/6 and BALB/c transgenic mice with an in-frame deletion of exon 4 of Rpgr show retinal degeneration that is rod or cone dominated, respectively.
Overexpression of isoform 1 results in atypical accumulation of Rpgr in photoreceptor outer segments, abnormal photoreceptor morphology and severe retinal degeneration.
In a mouse model of X-linked retinosa pigmentosa, where a 32bp duplication leads to a frameshift in the reading frame and a premature stop codon in isoform 5 (ORF15), mice exhibited retinal pathology including pigment loss and a slow progressive decrease in outer nuclear layer thickness.
Keywords
Alternative splicing
Cell projection
Cilium
Complete proteome
Cytoplasm
Cytoskeleton
Flagellum
Golgi apparatus
Guanine-nucleotide releasing factor
Lipoprotein
Methylation
Phosphoprotein
Prenylation
Reference proteome
Repeat
Retinitis pigmentosa
Sensory transduction
Vision
Feature
chain X-linked retinitis pigmentosa GTPase regulator
propeptide Removed in mature form
splice variant In isoform 4.
PDB
4JHN
E-value=3.5296e-22,
Score=252
Ontologies
Topology
Subcellular location
Golgi apparatus
In the retinal photoreceptor cell layer, localizes at the connecting cilium (By similarity). Colocalizes with WHRN in the photoreceptor connecting cilium (By similarity). Colocalizes with CEP290 in the photoreceptor connecting cilium (By similarity). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (By similarity). With evidence from 3 publications.
Cytoplasm
In the retinal photoreceptor cell layer, localizes at the connecting cilium (By similarity). Colocalizes with WHRN in the photoreceptor connecting cilium (By similarity). Colocalizes with CEP290 in the photoreceptor connecting cilium (By similarity). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (By similarity). With evidence from 3 publications.
Cytoskeleton
In the retinal photoreceptor cell layer, localizes at the connecting cilium (By similarity). Colocalizes with WHRN in the photoreceptor connecting cilium (By similarity). Colocalizes with CEP290 in the photoreceptor connecting cilium (By similarity). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (By similarity). With evidence from 3 publications.
Cilium basal body
In the retinal photoreceptor cell layer, localizes at the connecting cilium (By similarity). Colocalizes with WHRN in the photoreceptor connecting cilium (By similarity). Colocalizes with CEP290 in the photoreceptor connecting cilium (By similarity). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (By similarity). With evidence from 3 publications.
Microtubule organizing center
In the retinal photoreceptor cell layer, localizes at the connecting cilium (By similarity). Colocalizes with WHRN in the photoreceptor connecting cilium (By similarity). Colocalizes with CEP290 in the photoreceptor connecting cilium (By similarity). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (By similarity). With evidence from 3 publications.
Centrosome
In the retinal photoreceptor cell layer, localizes at the connecting cilium (By similarity). Colocalizes with WHRN in the photoreceptor connecting cilium (By similarity). Colocalizes with CEP290 in the photoreceptor connecting cilium (By similarity). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (By similarity). With evidence from 3 publications.
Cilium axoneme
In the retinal photoreceptor cell layer, localizes at the connecting cilium (By similarity). Colocalizes with WHRN in the photoreceptor connecting cilium (By similarity). Colocalizes with CEP290 in the photoreceptor connecting cilium (By similarity). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (By similarity). With evidence from 3 publications.
Flagellum axoneme
In the retinal photoreceptor cell layer, localizes at the connecting cilium (By similarity). Colocalizes with WHRN in the photoreceptor connecting cilium (By similarity). Colocalizes with CEP290 in the photoreceptor connecting cilium (By similarity). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (By similarity). With evidence from 3 publications.
Cell projection
In the retinal photoreceptor cell layer, localizes at the connecting cilium (PubMed:29899041). Colocalizes with WHRN in the photoreceptor connecting cilium (PubMed:22323458). Colocalizes with CEP290 in the photoreceptor connecting cilium (PubMed:16632484). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (PubMed:15772089). With evidence from 6 publications.
Cilium
In the retinal photoreceptor cell layer, localizes at the connecting cilium (PubMed:29899041). Colocalizes with WHRN in the photoreceptor connecting cilium (PubMed:22323458). Colocalizes with CEP290 in the photoreceptor connecting cilium (PubMed:16632484). Colocalizes with RPGRIP1 in the photoreceptor connecting cilium (PubMed:15772089). With evidence from 6 publications.
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.03012
Exp number, first 60 AAs:
0.02228
Total prob of N-in:
0.27683
Population Genetic Test Statistics
Interpretation
Possibly Positive selection
Multiple alignment of Orthologues
Gene Tree