SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16713
Annotation
beta-lactamase_protein_TEM-1b_[Escherichia_coli_UMNF18]
Full name
Beta-lactamase      
Location in the cell
Cytoplasmic   Reliability : 1.52 Mitochondrial   Reliability : 1.408
 

Sequence

CDS
ATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA
Protein
MMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Summary

Catalytic Activity
a beta-lactam + H2O = a substituted beta-amino acid
Miscellaneous
The sequence shown here is derived from an EMBL/GenBank/DDBJ third party annotation (TPA) entry.
Similarity
Belongs to the class-A beta-lactamase family.
Feature
chain  Beta-lactamase
EC Number
3.5.2.6
EMBL
AGTD01000004    AEJ60089.1    MH140434    AXS01178.1    KY865321    ARX61637.1    + More
KU605916    AMJ32525.1    LJEB01000186    KPR47434.1    MH257754    MH626559    MH648141    AB605179    AXY98470.1    AXY99059.1    AXY99190.1    BAL48677.1    LT985247    SPD98901.1    SPD98914.1    KP308218    AKH61026.1    ROVY01000279    MHI24989.1    AAACHK010000082    EAA6978786.1    KU544811    AMP48687.1    AAAFQE010000185    AAAFQE010000321    EAB7439126.1    EAB7439383.1    ROVY01000181    MHI24813.1    AAACHK010000060    EAA6978672.1    KP265296    AJC00149.1    KJ201887    AJQ17388.1    JQ432559    JX627737    KJ020575    AFI99182.1    AFV92772.1    AIT41501.1    AAAGGM010000296    EAB9437525.1    LZCC01000066    OFE15796.1    FJ621586    ACQ77747.1    MF593878    AWX65696.1    MF593880    AWX65698.1    KJ201886    AJQ17374.1    DQ355980    ABD61074.1    KC783461    AGK82336.1    MF370948    AWK68067.1    MF593882    AWX65700.1    KR149127    AKR79509.1    NMVR01000058    PJG36930.1    AXUK01000008    ESA99428.1    CP001856    ADR29904.1    HM804085    ADL40245.1    KF906263    AHJ40635.1    MF593881    AWX65699.1    KF182193    AGP03452.1    UGKT01000002    STV74876.1    BN000925    CAJ85677.1    UGUB01000002    UGUB01000003    SUC42236.1    SUC42912.1    SUD65240.1    FLXG01000005    SBX65079.1    KX127548    APO32365.1    KY612437    ASZ00337.1    Y07702    CAA68966.1    AF012911    AAB97881.1    QMHZ01000029    RBA77429.1    UGHS01000004    STO93343.1    AP010961    BAI39097.1    LPPZ01000054    KTJ24659.1    CP026210    AUZ62430.1    AYLZ02000212    EYR78152.1    AWCM01000011    EQY30197.1    JNQF01000023    KDX43877.1    AYLO01000180    ESS66025.1    LJSM01000003    KZD86031.1    CP016990    AXV35323.1    JZKT01000094    KJX27886.1    LJDX02000075    OCO25753.1    AKAX01000349    EJE83116.1    ADTR01000390    EFK19121.1    JOSR01000290    KEO18121.1    CBWM010000771    CDL23543.1    ADJZ01000019    OSL64378.1    CP000057    ABU87507.1    RZII01000035    RUR50831.1    PQJV01000021    POW53520.1    CP020452    ARC51413.1    AXUI01000063    ESA91053.1    JCLQ01000019    EUM73878.1    CP003290    AFS76959.1    ADTK01000215    EFJ86711.1    QDLK01000109    PVI68094.1    QVQG01000055    RFU07856.1    AVVI01000079    EQP96544.1    RHXB01000032    RSE21488.1    AKAW01000043    EJE75188.1    QBFJ01000051    RDZ21504.1    CP026194    AUV04366.1    NLFL01000008    OZN27425.1    QFQJ01000215    PZQ83246.1    PCFB01000144    PVU49189.1    MNCH01000017    PIJ73148.1    ADJV01000024    OSL42187.1    QDLA01000013    PVI22842.1    ADWQ01000124    EFU32242.1    PXJD01000024    PSD34723.1    JMTN01000069    KHJ36494.1    QDOG01000032    PVL85888.1    NEEU01000013    PJD72579.1    JNMS01000113    KDU22296.1    CBWL010000070    CDL13493.1    AXTS01000134    ESD81813.1    CDMV01000066    CEL88611.1    AXUG01000008    ESA69828.1    PTHR02000078    ROC55849.1    AYKS02000095    KEY57265.1    RKJA01000002    RSC66085.1    CP028197    AVS54907.1   
Interpro
IPR000871   Beta-lactam_class-A        + More
IPR012338   Beta-lactam/transpept-like       
IPR023650   Beta-lactam_class-A_AS       
SUPFAM
SSF56601   SSF56601       
PDB
1ZG4     E-value=6.50706e-116,     Score=1064

Ontologies

Topology

SignalP
Position:   1 - 19,         Likelihood:  0.738921
 
 
Length:
221
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01118
Exp number, first 60 AAs:
0.00236
Total prob of N-in:
0.03486
outside
1  -  221
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号