SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16712
Annotation
TEM_family_class_A_beta-lactamase?_partial_[Escherichia_coli]
Full name
Beta-lactamase      
Location in the cell
Cytoplasmic   Reliability : 2.201
 

Sequence

CDS
ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA
Protein
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Summary

Catalytic Activity
a beta-lactam + H2O = a substituted beta-amino acid
Similarity
Belongs to the class-A beta-lactamase family.
Feature
chain  Beta-lactamase
EC Number
3.5.2.6
EMBL
Y07702    CAA68966.1    AF012911    AAB97881.1    QMHZ01000029    RBA77429.1    + More
UGHS01000004    STO93343.1    AP010961    BAI39097.1    LPPZ01000054    KTJ24659.1    CP026210    AUZ62430.1    AYLZ02000212    EYR78152.1    AWCM01000011    EQY30197.1    JNQF01000023    KDX43877.1    AYLO01000180    ESS66025.1    LJSM01000003    KZD86031.1    CP016990    AXV35323.1    JZKT01000094    KJX27886.1    LJDX02000075    OCO25753.1    AKAX01000349    EJE83116.1    ADTR01000390    EFK19121.1    JOSR01000290    KEO18121.1    CBWM010000771    CDL23543.1    ADJZ01000019    OSL64378.1    CP000057    ABU87507.1    RZII01000035    RUR50831.1    PQJV01000021    POW53520.1    CP020452    ARC51413.1    AXUI01000063    ESA91053.1    JCLQ01000019    EUM73878.1    CP003290    AFS76959.1    ADTK01000215    EFJ86711.1    QDLK01000109    PVI68094.1    QVQG01000055    RFU07856.1    AVVI01000079    EQP96544.1    RHXB01000032    RSE21488.1    AKAW01000043    EJE75188.1    QBFJ01000051    RDZ21504.1    CP026194    AUV04366.1    NLFL01000008    OZN27425.1    QFQJ01000215    PZQ83246.1    PCFB01000144    PVU49189.1    MNCH01000017    PIJ73148.1    ADJV01000024    OSL42187.1    QDLA01000013    PVI22842.1    ADWQ01000124    EFU32242.1    PXJD01000024    PSD34723.1    JMTN01000069    KHJ36494.1    QDOG01000032    PVL85888.1    NEEU01000013    PJD72579.1    JNMS01000113    KDU22296.1    CBWL010000070    CDL13493.1    AXTS01000134    ESD81813.1    CDMV01000066    CEL88611.1    AXUG01000008    ESA69828.1    PTHR02000078    ROC55849.1    AYKS02000095    KEY57265.1    RKJA01000002    RSC66085.1    CP028197    AVS54907.1    JOQU01000022    KEL67820.1    AXUF01000001    ESA77433.1    ADJB01000102    OSK99538.1    JOSK01000093    KEN96525.1    JOSH01000252    KEN63766.1    JONE01000071    KEJ70251.1    CP001125    ACF88509.1    AXTL01000004    ESD46492.1    PQGD01000039    POP41554.1    ADWT01000136    EFK65172.1    LN869922    CRZ20101.1    CVNB01000046    CRH25690.1    CP026236    AUV29077.1    PUBY01000043    PQI97065.1    MARB01000043    ODJ85639.1    AAZI01000007    EDK11268.1    AXUE01000108    ESA71798.1    AXUL01000009    ESB03532.1    CP026188    AUV04841.1    ADTS01000006    EGB90421.1    CU928163    CAR15942.1    CP022442    AZZ16694.1    CP000971    ACB20291.1    CP009053    ASQ70304.1    RKJH01000001    RSC55876.1    AXTE01000030    ESD09970.1    AP012495    BAM50254.1    BAM51945.1    BAM54074.1    BAM54300.1    BAM55114.1    LJER02000109    LJEY02000061    NPGK01000080    OEH00348.1    OEH18188.1    OZP65011.1    LEUS01000034    MRWY01000002    PIET01000013    QVNS01000064    QKOQ01000102    KLY22168.1    OLP14575.1    PLM68964.1    RJP06239.1    RWS76466.1    GQ983330    MTCP01000050    ADN79087.1    OLY66183.1    NIYQ01000101    NXMF01000006    UIPE01000253    PAY72548.1    POR92509.1    SVH33955.1    AY302260    EU855787    EU855788    GQ336884    HM131427    GQ983322    HQ665010    JX101693    KM877517    KY466939    KY466941    KY466942    KY466945    KY466949    CP029717    LC099945    CP035633    CP035635    CP035638    NRQN01000086    QKOM01000139    QKON01000117    FKDD01000043    FKED01000050    FKEV01000032    FKGC01000020    FKIV01000020    AAQ73497.1    ACO53995.1    ACO54305.1    ACU68557.1    ADI82847.1    ADN79079.1    AEK70518.1    AFQ93512.1    AKA21110.1    ASF87064.1    ASF87066.1    ASF87067.1    ASF87070.1    ASF87074.1    AWS81559.1    BAT62125.1    QBB03475.1    QBB08452.1    QBB08717.1    RLS12878.1    RWS56794.1    RWS62473.1    SAD52190.1    SAF08455.1    SAF35486.1    SAG19325.1    SAJ19046.1    JX268608    PDLE01000004    AFN82037.1    PHH10446.1    AM849806    MPJK01000001    QEPW01000003    CAO98722.1    OLV29346.1    RDE95593.1    FJ167861    LPOU01000028    MTZP01000687    FKAH01000038    ACI16364.1    KTH77668.1    KTH77675.1    OOL21103.1    SAB48683.1    LESN01000010    LESN01000007    KLV50760.1    KLV51582.1    CP031122    AXH60626.1    AXH60753.1    AP018830    PTHX02000014    BBF82950.1    ROC96166.1    EF035571    GQ983316    JX268615    JX268624    CP011627    CP011629    CP011632    CP011634    CP011635    CP026272    ABM89172.1    ADN79073.1    AFN82044.1    AFN82053.1    AKL32382.1    AKL32437.1    AKL32590.1    AKL32896.1    AKL32991.1    AKL33197.1    AUV95589.1    CP022696    CP022697    CP022698    AST82600.1    AST82646.1    AST82785.1    AST82974.1    KY978628    CP028975    ASR81884.1    AZP35718.1    CP011598    CP011601    AKL09816.1    AKL10352.1   
Proteomes
UP000252789    UP000255264    UP000001614    UP000053549    UP000266790    UP000017832    + More
UP000015992    UP000027743    UP000017842    UP000076589    UP000264309    UP000033354    UP000050507    UP000006328    UP000005688    UP000027995    UP000019203    UP000193619    UP000002525    UP000268571    UP000246545    UP000191272    UP000017474    UP000020881    UP000006167    UP000005176    UP000245840    UP000263964    UP000016034    UP000275331    UP000006261    UP000256403    UP000236230    UP000215867    UP000249282    UP000245813    UP000229786    UP000193714    UP000245906    UP000005056    UP000238020    UP000031461    UP000245147    UP000230495    UP000027892    UP000019191    UP000017634    UP000041838    UP000017579    UP000285498    UP000017810    UP000269273    UP000240979    UP000027710    UP000017268    UP000193045    UP000027703    UP000030114    UP000027912    UP000001865    UP000017618    UP000247005    UP000003390    UP000067979    UP000047880    UP000236550    UP000238742    UP000094769    UP000005706    UP000017485    UP000017394    UP000236524    UP000005960    UP000007097    UP000284891    UP000007011    UP000259767    UP000277377    UP000017402    UP000011218    UP000050495    UP000216915    UP000036305    UP000186372    UP000234661    UP000280877    UP000288962    UP000185597    UP000217868    UP000237029    UP000257965    UP000077264    UP000077278    UP000077295    UP000077310    UP000077423    UP000248239    UP000286016    UP000288940    UP000288980    UP000290061    UP000224601    UP000187082    UP000253910    UP000054500    UP000077207    UP000189103    UP000036592    UP000256296    UP000285186    UP000035545    UP000236461    UP000215286    UP000275517    UP000035479   
Interpro
IPR000871   Beta-lactam_class-A        + More
IPR023650   Beta-lactam_class-A_AS       
IPR012338   Beta-lactam/transpept-like       
SUPFAM
SSF56601   SSF56601       
PDB
1ZG4     E-value=6.14145e-157,     Score=1420

Ontologies

Topology

SignalP
Position:   1 - 23,         Likelihood:  0.980093
 
 
Length:
286
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
7.23271999999998
Exp number, first 60 AAs:
7.14333999999999
Total prob of N-in:
0.35473
outside
1  -  286
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号