SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16710
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Full name
Integrin beta      
Location in the cell
Nuclear   Reliability : 2.631
 

Sequence

CDS
ATGGGCGACTTTAATGCCAAAGTGGGTGTACAGATGTGTGACGAATCAAGAGTGGGACCACATGGATTTGGAAGCAGGAACGATAGGGGGCAAATGCTCGTTAACTTTCTAGAGCAAGAGGAGCTATTCTTAATGAACTCATTTTTTAAAAAGCAGCCCCAAAGAAAATGGACATGGCGAAGCCCGGACACTGTAACGAAAAATGAGATTGATTTTATCATTGCGGACAAAAAACGGTTATTTAGGGATGTCTCAGTGGTCAACAGGTTTAACACCGGAAGCGACCACCGGCTAGTAAGAGCTACGCTGAGCATAGACACTCGATTGGAAAGATACCGCATGATACAGTCTACACTCCGACCTAGCCAGCTCCAAATCAGTGCAGGTTCAGAAGTTTTCCATAAAACCTTGGAAAATCGATTTGTTAACTTGGAAACCACTGATGATGTTGACGAAAACCTCGAAAATCTGGTCACACTCATGAGGGAAGAGGGTGCAAAATTTTTCAGCGGGAAGCGAACGGGAAAAAAATCCGAACTCTCAGACGAGACGTTGCGACTCATGGCCATACGGCGACATTTCAAAAATTCTGCTTAA
Protein
MGDFNAKVGVQMCDESRVGPHGFGSRNDRGQMLVNFLEQEELFLMNSFFKKQPQRKWTWRSPDTVTKNEIDFIIADKKRLFRDVSVVNRFNTGSDHRLVRATLSIDTRLERYRMIQSTLRPSQLQISAGSEVFHKTLENRFVNLETTDDVDENLENLVTLMREEGAKFFSGKRTGKKSELSDETLRLMAIRRHFKNSA

Summary

Similarity
Belongs to the integrin beta chain family.
Feature
chain  Integrin beta
EMBL
FJ265550    ADI61818.1    RSAL01000359    RVE42210.1    RSAL01000220    RVE44071.1    + More
FJ265542    ADI61810.1    FJ265545    ADI61813.1    FJ265543    ADI61811.1    KZ150353    PZC71243.1    FJ265544    ADI61812.1    FJ265549    ADI61817.1    FJ265551    ADI61819.1    RSAL01001818    RVE40675.1    RSAL01000057    RVE49824.1    RSAL01003087    RVE40344.1    JARK01000126    EYC42577.1    GEDV01005625    JAP82932.1    GEDV01000266    JAP88291.1    JARK01001338    EYC33045.1    JARK01001351    EYC23458.1    JARK01001345    EYC27376.1    EYC27377.1    JARK01001424    EYC04321.1    JARK01001372    EYC15676.1    JARK01001389    EYC10853.1    JARK01001565    EYB89683.1    JARK01001676    JARK01001446    JARK01001433    EYB83199.1    EYC01126.1    EYC02928.1    JARK01001337    EYC34625.1    MRZV01000269    PIK53948.1    ODYU01004088    SOQ43598.1    JARK01001340    EYC31168.1    JARK01001354    EYC21713.1    EYC21986.1    AMQN01035462    KB292293    ELU17851.1    AMQN01039158    KB295056    ELU13765.1    JARK01001435    EYC02484.1    GBBM01003763    JAC31655.1    AMQN01002170    AMQN01002171    KB308559    ELT97455.1    JTDY01000008    KOB79474.1    GEFH01000854    JAP67727.1    JARK01001341    EYC30403.1    JARK01001655    EYB84321.1    MRZV01000899    PIK42832.1    CAVP010052198    CDL93746.1    KZ149907    PZC78256.1    JARK01001358    EYC20230.1    AAGJ04050748    UZAF01016227    VDO23583.1    JTDY01000715    KOB76117.1    KZ345286    PIO74399.1    KZ150150    PZC72845.1    JTDY01000781    KOB75903.1    NWSH01001447    PCG71212.1    KZ346514    PIO69792.1    EYC33365.1    GDKW01001596    JAI54999.1    FJ265561    ADI61829.1    KZ150049    PZC74456.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF13520   AA_permease_2
PF00362   Integrin_beta
PF05485   THAP
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR027124   Swc5/CFDP2       
IPR020846   MFS_dom       
IPR002293   AA/rel_permease1       
IPR032695   Integrin_dom_sf       
IPR036465   vWFA_dom_sf       
IPR015812   Integrin_bsu       
IPR002035   VWF_A       
IPR002369   Integrin_bsu_VWA       
IPR038441   THAP_Znf_sf       
IPR006612   THAP_Znf       
IPR016186   C-type_lectin-like/link_sf       
IPR016187   CTDL_fold       
IPR007110   Ig-like_dom       
IPR036179   Ig-like_dom_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF53300   SSF53300       
SSF69179   SSF69179       
SSF56436   SSF56436       
SSF48726   SSF48726       

Ontologies

Topology

Subcellular location
Membrane  
Length:
198
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00096
Exp number, first 60 AAs:
0.00096
Total prob of N-in:
0.08390
outside
1  -  198
 
 

Population Genetic Test Statistics

Pi
13.318289
Theta
19.523609
Tajima's D
-0.987787
CLR
0
CSRT
0.139643017849108
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号