SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16698
Pre Gene Modal
BGIBMGA014318
Annotation
PREDICTED:_uncharacterized_protein_LOC101736599_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 1.056
 

Sequence

CDS
ATGAAGAGTTCGATGTGTAGTGATGTCGCGCCGGTGCACTGGAGTAAGTCGATGGACCGGCTCGGCGAGCTCCTGAGTCCGGCCGAGGAGACCATATCGATGTTCACGCAGCTGAGCGACAAGCTGAGCGAGGTGTCCGCGGCCGAGGGGGACAGCGGCGTCGACACGGCGCACGTCTCCGACGACGAAGCCTGCAGGCCAGAGAAATGGACGATACTGGACCTGCAGTTCGGCATCCCGCTATTCGACGAGGCGCTTTGCGAGTCCGTGTGCGGCAGCGTGGTGGGCTGTGTGGCGGCGCCAGACGTGTGA
Protein
MKSSMCSDVAPVHWSKSMDRLGELLSPAEETISMFTQLSDKLSEVSAAEGDSGVDTAHVSDDEACRPEKWTILDLQFGIPLFDEALCESVCGSVVGCVAAPDV

Summary

Pfam
PF14648   FAM91_C        + More
PF14647   FAM91_N
PF13891   zf-C3Hc3H
Interpro
IPR039199   FAM91        + More
IPR028097   FAM91_C_dom       
IPR028091   FAM91_N_dom       
IPR025927   Potential_DNA-bd       

Ontologies

GO

Topology

Length:
103
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00614
Exp number, first 60 AAs:
0.00018
Total prob of N-in:
0.35318
outside
1  -  103
 
 

Population Genetic Test Statistics

Pi
3.544524
Theta
3.891284
Tajima's D
-0.237331
CLR
0
CSRT
0.325183740812959
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号