SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16696
Pre Gene Modal
BGIBMGA012643
Annotation
PREDICTED:_protein_FAM91A1_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.159 Extracellular   Reliability : 1.168
 

Sequence

CDS
ATGACAGCCGCTGAACGGGGTCTGGTGTACGTGGACGTGCCTATAACGGCGGCTGATAAGGTGTCCGTCCCTCCGTTGAAGGGCTTCGTCATGAACCGTGTGGCCGGGGACTACTTCGAGACCTTGCTGTACAAGGTGTTCGTTTCCATCGACGAGCACACCGGGGTCGGGGAACTTGCTGCCGTCCTCCAGGTTGACTGCGAGCTGGTGAAGCAAGCGGTTTCGCTGTACTGCCGGCTCGGGTTCGCGAACAACCTGCACCCCCCGCCCGTCTCCCCGCCGCACCCCTCCTGGAGCGACGCGGTCACGACACACACCCATCCGCCGTGA
Protein
MTAAERGLVYVDVPITAADKVSVPPLKGFVMNRVAGDYFETLLYKVFVSIDEHTGVGELAAVLQVDCELVKQAVSLYCRLGFANNLHPPPVSPPHPSWSDAVTTHTHPP

Summary

EMBL
BABH01038918    BABH01038919    BABH01038920    ODYU01002616    SOQ40348.1    KQ459053    + More
KPJ04037.1    KQ461073    KPJ09574.1    KZ149982    PZC75777.1    JTDY01000937    KOB75366.1    NWSH01000823    PCG74012.1    AGBW02014073    OWR42318.1    BABH01038916    APGK01038498    KB740960    KB631698    ENN76984.1    ERL85474.1    LJIG01022752    KRT78908.1    KQ971382    EEZ97172.2    KB199650    ESP05148.1    KK121883    KFM81468.1    GECZ01000994    JAS68775.1    MRZV01000600    PIK47121.1    NBAG03000213    PNI85620.1    NDHI03003373    PNJ76297.1    AC011134    LJIJ01000088    ODN03046.1    NEVH01010479    PNF32474.1    GEZM01063052    GEZM01063051    JAV69347.1    GECU01009708    JAS97998.1    GECU01021057    JAS86649.1    KK852927    KDR13698.1    IACL01003597    LAA99152.1    GEDC01006461    JAS30837.1    GDIP01228313    JAI95088.1    GDIP01197518    JAJ25884.1    GL732557    EFX78521.1    JH431887    GDIQ01134511    JAL17215.1    GDIP01228314    JAI95087.1    GEDC01029987    JAS07311.1    GDIQ01141573    JAL10153.1    GDIQ01054399    JAN40338.1    GDIP01047636    JAM56079.1    GDIP01205619    JAJ17783.1    GDIQ01266318    JAJ85406.1    GDIQ01134512    JAL17214.1    GDIQ01005922    JAN88815.1    GDIP01046142    LRGB01001581    JAM57573.1    KZS11050.1    GDIP01226112    JAI97289.1    GEDC01015637    GEDC01014298    GEDC01009046    JAS21661.1    JAS23000.1    JAS28252.1    GBYX01191548    JAO82659.1    GCES01058163    JAR28160.1    NEDP02000216    OWF56343.1    GBYX01191539    JAO82668.1    GDIQ01061253    JAN33484.1    GCES01058162    JAR28161.1    KQ425731    KOF69057.1    GDIP01126379    JAL77335.1    IACJ01068194    LAA44559.1    GBBI01003587    JAC15125.1    GDIP01021956    JAM81759.1    JH817025    EKC27428.1    KL871000    KGL90027.1    AAGJ04012144    GDIP01049283    JAM54432.1    GDIP01173863    JAJ49539.1    GDIQ01266319    JAJ85405.1    GDIQ01175202    JAK76523.1    GBYX01191550    JAO82658.1    KK578088    KFW11768.1    GEBQ01020460    JAT19517.1    GDIP01046143    JAM57572.1    GDIP01044588    JAM59127.1    GBYX01191542    JAO82665.1    KK620508    KFV50947.1    GDIP01051997    JAM51718.1    GDIP01142833    JAL60881.1    GDIQ01117732    JAL33994.1    ADBJ01000017    EFA83323.1    RQTK01000752    RUS75324.1    KL313866    KFP53606.1    KL371719    KFP80970.1    DS985247    EDV23394.1    GDIP01137224    JAL66490.1    NCKU01002305    RWS09884.1    NOWV01000078    RDD41334.1    KZ506422    PKU39726.1    CP026264    AWP21684.1    AMQN01007978    KB301890    ELU04994.1    GDIP01205618    JAJ17784.1    JW868350    AFP00868.1    GBYX01191541    JAO82666.1    HAEB01020779    SBQ67306.1    KE346362    KJE91689.1   
Pfam
PF14648   FAM91_C        + More
PF14647   FAM91_N
Interpro
IPR028097   FAM91_C_dom        + More
IPR039199   FAM91       
IPR028091   FAM91_N_dom       
IPR000048   IQ_motif_EF-hand-BS       

Ontologies

GO

Topology

Length:
109
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01171
Exp number, first 60 AAs:
0.01133
Total prob of N-in:
0.24644
outside
1  -  109
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号