SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16689
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.765 Nuclear   Reliability : 1.331
 

Sequence

CDS
ATGCGATCGGCCATGGATAAACTCAGAAAAGTATGGAAGGACCGGAATATCACCAAGACTACCAAAGTCCGACTGGTAAGGGCACTGGTGTTCCCCATCTTTTTATATGGGGTTGAGACCTCGACTGTGAAAGAAAGAGAAAAAAGAAGGATCGATGCATTAGAAATGTGTTGCTGGAGAAGGATGCTCCCTGTTTTGAGGATTAATCCAGATTTTTCAAAGATTTATTGA
Protein
MRSAMDKLRKVWKDRNITKTTKVRLVRALVFPIFLYGVETSTVKEREKRRIDALEMCCWRRMLPVLRINPDFSKIY

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
76
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
9.67688
Exp number, first 60 AAs:
9.67688
Total prob of N-in:
0.84408
inside
1  -  76
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号