SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16676  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA014524
Annotation
serine_protease_precursor_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 2.526
 

Sequence

CDS
ATGAAGGTCTTCGCAGCAGTATTGATGGCGTTGGCGGCCGTGGTCGTGGCAGAAGAGCCCATCGAACTCGACTACCACATCAAGATCGGTATCCCCCGGGCCGAGAGTCTTAGACGCGCCGAGGAAGCCGCTGACTTCGACGGTACCAGGATTGTGGGTGGTTCTGCCGCCAACGCTGGTGCTCACCCCCATCTTGCTGGACTTGTGATCGCACTGACGAATGGCAGAACTTCCATCTGCGGAGCTTCCTTACTGACCAACACCCGCTCCGTGACCGCCGCTCATTGCTGGAGGACCAGGAGAGCCCAGGCTCGTCAGTTCACCCTCGCTCTTGGCACAGCTAACATCTTCTCCGGAGGCACCAGGGTCACCACCTCCAATGTCCAGATGCACGGCAGCTACAACATGGACACCCTCCACAACGACGTCGCCATCATCAACCACAACCATGTTGGCTTCACCAACAACATCCAGCGCATCAACCTAGCCAGTGGAAGCAACAACTTTGCTGGTACTTGGGCCTGGGCTGCCGGCTTCGGAAGGACCTCCGATGCTGCTTCGGGAGCCAACAACCAACAAAAACGCCAAGTGAGCCTCCAGGTCATTACCAACGCCGTCTGCGCCCGCACGTTTGGAAACAATGTGATCATTGCCTCCACCCTCTGTGTTGACGGCTCTAACGGTCGCAGCACCTGCAGCGGAGACTCCGGCGGCCCTCTCACCATCGGCAGCGGCGGAAGCCGTCAACTGATCGGTATCACATCGTTCGGATCAGCTCAAGGTTGCCAGAGAGGCCACCCTGCCGGCTTCGCCAGAGTCACATCCTTCAACTCCTGGATCCGGGCTAGAATTTAA
Protein
MKVFAAVLMALAAVVVAEEPIELDYHIKIGIPRAESLRRAEEAADFDGTRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHCWRTRRAQARQFTLALGTANIFSGGTRVTTSNVQMHGSYNMDTLHNDVAIINHNHVGFTNNIQRINLASGSNNFAGTWAWAAGFGRTSDAASGANNQQKRQVSLQVITNAVCARTFGNNVIIASTLCVDGSNGRSTCSGDSGGPLTIGSGGSRQLIGITSFGSAQGCQRGHPAGFARVTSFNSWIRARI

Summary

Similarity
Belongs to the peptidase S1 family.
Belongs to the ETS family.
EMBL
BABH01042790    AB003670    BAA20136.1    BABH01041852    AB117641    BAD13342.1    + More
BABH01041859    BABH01041860    AY945210    EU338400    AAX39408.1    ABY58153.1    AY945211    DQ310733    AAX39409.1    ABC26003.1    BABH01041861    BABH01041853    KQ459472    KPJ00237.1    KQ459586    KPI97880.1    BABH01041868    KF039687    AGU27161.1    KQ459581    KPI99177.1    KZ150191    PZC72392.1    KQ461033    KPJ09997.1    KQ460401    KPJ14971.1    KQ458725    KPJ05397.1    KQ458978    KPJ04519.1    KPJ05400.1    FJ205420    ACR15987.3    KQ460845    KPJ12032.1    KM083780    AIR09761.1    RSAL01000073    RVE48982.1    NWSH01001385    PCG71452.1    KPJ05401.1    KQ460140    KPJ17495.1    KPJ17496.1    ODYU01007826    SOQ50918.1    KR024679    ALE15221.1    AGBW02011570    OWR46476.1    KR024680    ALE15222.1    AY953056    AY953057    AAX62029.1    AAX62030.1    JQ904141    AFM77771.1    KPJ05396.1    JQ904140    AFM77770.1    EU672968    ACD44927.1    KQ459388    KPJ01122.1    KQ459620    KPJ20544.1    BABH01027594    KQ459185    KPJ03332.1    GDQN01000181    JAT90873.1    AF233732    AAF71519.1    KPJ17494.1    KM360186    AKH49602.1    KQ459591    KPI97041.1    KQ461198    KPJ05938.1    Y12287    CAA72966.1    Y12281    CAA72960.1    FJ205404    ACR15972.2    NWSH01000291    PCG77692.1    KQ459252    KPJ02116.1    AY618891    AAV33654.1    PCG77697.1    Y12280    CAA72959.1    EF531623    ABR88234.1    PCG77696.1    KT907053    AMR44225.1    EF531624    ABR88235.1    AF233731    AF233734    AAF71518.1    AAF71716.1    PCG77694.1    AY618892    AAV33655.1    PCG77693.1    BABH01023267    HM990178    ADT80826.1    EU673454    ACI45417.1    JN252035    AFM28248.1    EF531626    ABR88237.1    FJ205413    ACR15981.1    NWSH01000651    PCG75015.1    FJ205424    ACR15991.1    HM990183    ADT80831.1    HM990173    ADT80821.1    EF531625    ABR88236.1    JTDY01002254    KOB71786.1    AY953058    AAX62031.1    HM209420    ADI32881.1    KM083791    ODYU01000971    AIR09772.1    SOQ36530.1    GQ354838    ACU00133.1    SOQ36529.1    NWSH01002619    PCG67834.1    PCG67835.1    HM209421    ADI32882.1    Y12279    CAA72958.1    HM209419    ADI32880.1    KC175563    AGR92346.1    EU325550    ACB54940.1    GQ891130    ADK27715.1    GU323796    ADA83701.1    SOQ36528.1    HM209422    ADI32883.1    AY251276    AAO75039.1    JQ904139    AFM77769.1    EF104914    ABP96916.1    HM990177    ADT80825.1    AY618895    AAV33658.1    NWSH01001552    PCG70875.1    JN252036    AFM28249.1    AF233728    AAF71515.1    GDQN01009850    JAT81204.1    FJ205412    ACR15980.1    JQ904136    AFM77766.1   
Pfam
PF00089   Trypsin        + More
PF00178   Ets
Interpro
IPR001314   Peptidase_S1A        + More
IPR009003   Peptidase_S1_PA       
IPR018114   TRYPSIN_HIS       
IPR001254   Trypsin_dom       
IPR033116   TRYPSIN_SER       
IPR036388   WH-like_DNA-bd_sf       
IPR036390   WH_DNA-bd_sf       
IPR000418   Ets_dom       
SUPFAM
SSF50494   SSF50494        + More
SSF46785   SSF46785       
Gene 3D
PDB
2HLC     E-value=1.12891e-32,     Score=348

Ontologies

Topology

Subcellular location
Nucleus  
SignalP
Position:   1 - 17,         Likelihood:  0.994812
 
 
Length:
284
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.35599
Exp number, first 60 AAs:
0.10333
Total prob of N-in:
0.03711
outside
1  -  284
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 INLASGSNNFAGTWAWAAGFGR 100.00 2e-10
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 EEAIELDYHNK 100.00 2e-10
28556443 IVGGSAANAGAHPHLAGLVIALTNGR 100.00 2e-10
28556443 EEPIELDYHIK 100.00 2e-10
28556443 AEEAADFDGTR 100.00 2e-10
28556443 STCSGDSGGPLTIGSGGSR 100.00 1e-05
28556443 RAEEAADFDGTR 100.00 1e-05
28556443 RAEEAADFDGTR 100.00 1e-05
28556443 QFTLALGTANIFSGGTR 100.00 1e-04
28556443 LAGLVIALTNGR 100.00 1e-04
28556443 LAGLVIALTNGR 100.00 1e-04
28556443 QLIGITSFGSAQGCQR 100.00 2e-04
28556443 QLIGITSFGSAQGCQR 100.00 2e-04
28556443 QLIGITSFGSAQGCQR 100.00 2e-04
28556443 QLIGITSFGSAQGCQR 100.00 2e-04
28556443 LAGLVIALTNGR 100.00 2e-04
28556443 QLIGITSFGSAQGCQR 100.00 2e-04
28556443 QLIGITSFGSAQGCQR 100.00 2e-04
28556443 QLIGITSFGSAQGCQR 100.00 2e-04
28556443 QFTLALGTANIFSGGTR 100.00 2e-04
28556443 QFTLALGTANIFSGGTR 100.00 2e-04
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QLIGITSFGSAQGCQR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QLIGITSFGSDR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QVSLQVITNAVCAR 100.00 0.012
28556443 QLIGITSFGSAQGCQR 100.00 0.012
28556443 QLIGITSFGSAQGCQR 100.00 0.012
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号