SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16660
Pre Gene Modal
BGIBMGA007216
Annotation
PREDICTED:_lachesin-like_isoform_X1_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 2.078 PlasmaMembrane   Reliability : 1.48
 

Sequence

CDS
ATGTGGTACCGACACCGCCGTTCGGGGACTAGTACCACCGCTCTGCTCAAATCAGTTATAATAGTAGTGTGTTGTTTGGTTGTTGCAGTGTTGTCGTGTGGCGAGGCCGGCGGCGGCGGGCGGCTCGTGAAGCGCTACGTGGGGCTCTACACGGGACCCTACTTCGACCCCTCGGCGCCCAACAACATAACCACGCAGCTCGGCACGCACGCCTATCTGCCCTGCAAGGTCCGTCAGCTGAGCAACAAGTCGGTGTCGTGGATCCGGCGCCGGGACGCACACATCCTCACCGTGGACCGGTTCACGTTCATCGCCGACGAGCGCTTCCAAGCCTTCCTGGTCGAGGCGACCGACACCTGGACCTTGCAGGTCAGTCACCGCCCCACCGTCGCCCTACCGCCGCCCTACCATCGCTCTGTACTGCATTCCAACGCAAGTCGCGGTACCCTATCGGTAGAATGA
Protein
MWYRHRRSGTSTTALLKSVIIVVCCLVVAVLSCGEAGGGGRLVKRYVGLYTGPYFDPSAPNNITTQLGTHAYLPCKVRQLSNKSVSWIRRRDAHILTVDRFTFIADERFQAFLVEATDTWTLQVSHRPTVALPPPYHRSVLHSNASRGTLSVE

Summary

Pfam
PF07686   V-set
Interpro
IPR007110   Ig-like_dom        + More
IPR003599   Ig_sub       
IPR013783   Ig-like_fold       
IPR037448   Zig-8       
IPR013106   Ig_V-set       
IPR003598   Ig_sub2       
IPR036179   Ig-like_dom_sf       
SUPFAM
SSF48726   SSF48726       
Gene 3D
ProteinModelPortal
PDB
6NRR     E-value=7.85756e-22,     Score=250

Ontologies

GO

Topology

Length:
153
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
20.82844
Exp number, first 60 AAs:
20.81907
Total prob of N-in:
0.92959
POSSIBLE N-term signal
sequence
inside
1  -  12
TMhelix
13  -  32
outside
33  -  153
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号